BLASTX nr result
ID: Ophiopogon25_contig00043165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043165 (724 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX68415.1| hypothetical protein RirG_105370 [Rhizophagus irr... 54 2e-06 gb|PKC07267.1| hypothetical protein RhiirA5_359363 [Rhizophagus ... 54 2e-06 >gb|EXX68415.1| hypothetical protein RirG_105370 [Rhizophagus irregularis DAOM 197198w] Length = 327 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 495 RLVQYKHLEEHEARKKINNEVKDQLPRKFPKLQSERE*KELERFMTFF 352 RLVQY HLEEHEARKKIN EVKDQLP++ K ++ + + F Sbjct: 232 RLVQYNHLEEHEARKKINIEVKDQLPKEVSKAAVRKKIERARKIYDLF 279 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -3 Query: 356 FFRISDDKDQRID 318 FFRI+DDK+QRI+ Sbjct: 279 FFRITDDKNQRIE 291 >gb|PKC07267.1| hypothetical protein RhiirA5_359363 [Rhizophagus irregularis] gb|PKC65915.1| hypothetical protein RhiirA1_419926 [Rhizophagus irregularis] Length = 118 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 495 RLVQYKHLEEHEARKKINNEVKDQLPRKFPKLQSERE*KELERFMTFF 352 RLVQY HLEEHEARKKIN EVKDQLP++ K ++ + + F Sbjct: 23 RLVQYNHLEEHEARKKINIEVKDQLPKEVSKAAVRKKIERARKIYDLF 70 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -3 Query: 356 FFRISDDKDQRID 318 FFRI+DDK+QRI+ Sbjct: 70 FFRITDDKNQRIE 82