BLASTX nr result
ID: Ophiopogon25_contig00043117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043117 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY40385.1| hypothetical protein RhiirA4_394570 [Rhizophagus ... 148 8e-43 gb|EXX60640.1| hypothetical protein RirG_178060 [Rhizophagus irr... 148 8e-43 gb|PKC66057.1| hypothetical protein RhiirA1_419773 [Rhizophagus ... 148 8e-43 gb|KZT34434.1| hypothetical protein SISSUDRAFT_276635 [Sistotrem... 59 4e-07 gb|KZS88880.1| hypothetical protein SISNIDRAFT_459312 [Sistotrem... 59 4e-07 gb|PKC14242.1| hypothetical protein RhiirA5_350565, partial [Rhi... 54 3e-06 gb|KEP50458.1| PB1 domain protein [Rhizoctonia solani 123E] 55 6e-06 gb|EUC63980.1| PB1 domain protein [Rhizoctonia solani AG-3 Rhs1AP] 55 6e-06 ref|XP_007325801.1| hypothetical protein AGABI1DRAFT_110685 [Aga... 55 8e-06 dbj|GBC38496.1| hypothetical protein RIR_2241200 [Rhizophagus ir... 54 8e-06 >gb|PKY40385.1| hypothetical protein RhiirA4_394570 [Rhizophagus irregularis] Length = 173 Score = 148 bits (374), Expect = 8e-43 Identities = 73/79 (92%), Positives = 75/79 (94%) Frame = +3 Query: 192 MRTSVFKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 371 MRTS FKISNQAITRR TL E+PTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS Sbjct: 49 MRTSTFKISNQAITRRFTLSIEQPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 108 Query: 372 SQIELEDYYKQVKCHDYSD 428 SQIELEDYYKQVKCH+YSD Sbjct: 109 SQIELEDYYKQVKCHEYSD 127 >gb|EXX60640.1| hypothetical protein RirG_178060 [Rhizophagus irregularis DAOM 197198w] dbj|GBC38398.1| pb1 domain protein [Rhizophagus irregularis DAOM 181602] gb|PKC03934.1| hypothetical protein RhiirA5_362827 [Rhizophagus irregularis] gb|PKK64314.1| hypothetical protein RhiirC2_756884 [Rhizophagus irregularis] Length = 173 Score = 148 bits (374), Expect = 8e-43 Identities = 73/79 (92%), Positives = 75/79 (94%) Frame = +3 Query: 192 MRTSVFKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 371 MRTS FKISNQAITRR TL E+PTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS Sbjct: 49 MRTSTFKISNQAITRRFTLSIEQPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 108 Query: 372 SQIELEDYYKQVKCHDYSD 428 SQIELEDYYKQVKCH+YSD Sbjct: 109 SQIELEDYYKQVKCHEYSD 127 >gb|PKC66057.1| hypothetical protein RhiirA1_419773 [Rhizophagus irregularis] gb|PKY19704.1| hypothetical protein RhiirB3_407248 [Rhizophagus irregularis] Length = 175 Score = 148 bits (374), Expect = 8e-43 Identities = 73/79 (92%), Positives = 75/79 (94%) Frame = +3 Query: 192 MRTSVFKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 371 MRTS FKISNQAITRR TL E+PTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS Sbjct: 51 MRTSTFKISNQAITRRFTLSIEQPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITIS 110 Query: 372 SQIELEDYYKQVKCHDYSD 428 SQIELEDYYKQVKCH+YSD Sbjct: 111 SQIELEDYYKQVKCHEYSD 129 >gb|KZT34434.1| hypothetical protein SISSUDRAFT_276635 [Sistotremastrum suecicum HHB10207 ss-3] Length = 791 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/72 (38%), Positives = 41/72 (56%) Frame = +3 Query: 207 FKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIEL 386 FK+ Q R +E+PTWL L K+ +F IP+ + ++YID DD +T+SS EL Sbjct: 5 FKLVQQGGQTRRLSFQERPTWLALATKIESLFGIPAE-NVAVSYIDNDDDEVTLSSHEEL 63 Query: 387 EDYYKQVKCHDY 422 D+Y HD+ Sbjct: 64 HDFYTTGAFHDH 75 >gb|KZS88880.1| hypothetical protein SISNIDRAFT_459312 [Sistotremastrum niveocremeum HHB9708] Length = 1015 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/72 (38%), Positives = 41/72 (56%) Frame = +3 Query: 207 FKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIEL 386 FK+ Q R +E+PTWL L K+ +F IP+ + ++YID DD +T+SS EL Sbjct: 5 FKLVQQGGQTRRLSFQERPTWLALATKIESLFGIPAE-NVAVSYIDNDDDEVTLSSHEEL 63 Query: 387 EDYYKQVKCHDY 422 D+Y HD+ Sbjct: 64 HDFYTTGAFHDH 75 >gb|PKC14242.1| hypothetical protein RhiirA5_350565, partial [Rhizophagus irregularis] gb|PKC70498.1| hypothetical protein RhiirA1_414327, partial [Rhizophagus irregularis] gb|PKY14474.1| hypothetical protein RhiirB3_400336, partial [Rhizophagus irregularis] gb|PKY48499.1| hypothetical protein RhiirA4_404491, partial [Rhizophagus irregularis] Length = 129 Score = 53.5 bits (127), Expect = 3e-06 Identities = 27/73 (36%), Positives = 43/73 (58%) Frame = +3 Query: 207 FKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIEL 386 F ++ T + + KPTW +L K+R F+IP++ GLTY++ ++ I ISSQ EL Sbjct: 51 FSPTSSPTTFSIVITSVKPTWDQLSTKIRSQFNIPANFKFGLTYLNSDNNEIIISSQKEL 110 Query: 387 EDYYKQVKCHDYS 425 +Y+ Q K + S Sbjct: 111 NNYFFQHKDDELS 123 >gb|KEP50458.1| PB1 domain protein [Rhizoctonia solani 123E] Length = 1059 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 207 FKISNQAITRRLTLLE-EKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIE 383 FK+ ++ + R++T E+P+W EL K+ ++ SIP + + LTY+D D ITISSQ E Sbjct: 4 FKLQHRGLVRKVTFKNVEQPSWHELSWKIGDMCSIPHA-AVALTYLDPDGDKITISSQAE 62 Query: 384 LEDYY 398 L +YY Sbjct: 63 LREYY 67 >gb|EUC63980.1| PB1 domain protein [Rhizoctonia solani AG-3 Rhs1AP] Length = 1059 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 207 FKISNQAITRRLTLLE-EKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIE 383 FK+ ++ + R++T E+P+W EL K+ ++ SIP + + LTY+D D ITISSQ E Sbjct: 4 FKLQHRGLVRKVTFKNVEQPSWHELSWKIGDMCSIPHA-AVALTYLDPDGDKITISSQAE 62 Query: 384 LEDYY 398 L +YY Sbjct: 63 LREYY 67 >ref|XP_007325801.1| hypothetical protein AGABI1DRAFT_110685 [Agaricus bisporus var. burnettii JB137-S8] gb|EKM84099.1| hypothetical protein AGABI1DRAFT_110685 [Agaricus bisporus var. burnettii JB137-S8] Length = 656 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = +3 Query: 207 FKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIEL 386 FK+ ++TRR T P+W +L KV +FSIP +TY+D D+ IT+S++ EL Sbjct: 5 FKLKFDSLTRRATFAHH-PSWGQLSAKVASLFSIPQH-QVAVTYVDADDEEITLSTEEEL 62 Query: 387 EDYYK 401 +DYY+ Sbjct: 63 QDYYQ 67 >dbj|GBC38496.1| hypothetical protein RIR_2241200 [Rhizophagus irregularis DAOM 181602] gb|POG68301.1| hypothetical protein GLOIN_2v1638676 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 193 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/73 (36%), Positives = 43/73 (58%) Frame = +3 Query: 207 FKISNQAITRRLTLLEEKPTWLELELKVREIFSIPSSVSPGLTYIDEGDDNITISSQIEL 386 F ++ T + + KPTW +L K+R F+IP++ GLTY++ ++ I ISSQ EL Sbjct: 51 FSPTSSPTTFSIVITSVKPTWDQLSTKIRSQFNIPANFKFGLTYLNSDNNEIIISSQKEL 110 Query: 387 EDYYKQVKCHDYS 425 +Y+ Q K + S Sbjct: 111 NNYFFQHKDDELS 123