BLASTX nr result
ID: Ophiopogon25_contig00042784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00042784 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEI98094.1| Putative Ubiquitin-domain-containing protein [Rh... 71 6e-12 gb|OBZ85857.1| Ubiquitin domain-containing protein DSK2 [Choanep... 72 6e-12 gb|OMJ27414.1| Ubiquitin domain-containing protein DSK2 [Smittiu... 73 7e-12 ref|XP_023463993.1| ubiquitin-domain-containing protein [Rhizopu... 72 1e-11 gb|PKY49967.1| hypothetical protein RhiirA4_323771 [Rhizophagus ... 72 2e-11 gb|PKY28269.1| hypothetical protein RhiirB3_444355 [Rhizophagus ... 72 2e-11 dbj|GBC23567.1| Nuclear-enriched ubiquitin-like polyubiquitin-bi... 72 2e-11 emb|CEJ02938.1| Putative Ubiquitin-domain-containing protein [Rh... 71 2e-11 gb|ORX81711.1| hypothetical protein K493DRAFT_320600 [Basidiobol... 71 2e-11 gb|KFH64062.1| hypothetical protein MVEG_09887 [Mortierella vert... 71 2e-11 gb|EIE85678.1| hypothetical protein RO3G_10388 [Rhizopus delemar... 71 2e-11 emb|CEG72117.1| Putative Ubiquitin-domain-containing protein [Rh... 71 3e-11 gb|ORE19701.1| ubiquitin-domain-containing protein [Rhizopus mic... 71 4e-11 gb|OAD05611.1| hypothetical protein MUCCIDRAFT_155946 [Mucor cir... 70 5e-11 gb|EPB91035.1| hypothetical protein HMPREF1544_02104 [Mucor circ... 70 5e-11 dbj|GAN03914.1| conserved hypothetical protein [Mucor ambiguus] 70 6e-11 gb|OAQ36802.1| hypothetical protein K457DRAFT_131946 [Mortierell... 70 6e-11 gb|OMJ13510.1| Ubiquitin domain-containing protein DSK2 [Smittiu... 70 6e-11 emb|SAM01852.1| hypothetical protein [Absidia glauca] 70 7e-11 gb|ORY99738.1| hypothetical protein BCR42DRAFT_457471 [Absidia r... 70 8e-11 >emb|CEI98094.1| Putative Ubiquitin-domain-containing protein [Rhizopus microsporus] Length = 202 Score = 70.9 bits (172), Expect = 6e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIELL S Sbjct: 160 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIELLFS 199 >gb|OBZ85857.1| Ubiquitin domain-containing protein DSK2 [Choanephora cucurbitarum] Length = 310 Score = 72.4 bits (176), Expect = 6e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLSD 126 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L SD Sbjct: 268 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIEMLFSD 308 >gb|OMJ27414.1| Ubiquitin domain-containing protein DSK2 [Smittium culicis] Length = 410 Score = 72.8 bits (177), Expect = 7e-12 Identities = 38/65 (58%), Positives = 44/65 (67%) Frame = -2 Query: 320 DPSFLYGLGNLGXXXXXXXXXXXERFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIE 141 DP+ L N ER+ QL QLNDMGFWDPQKNIRALL++GGNVNAA+E Sbjct: 345 DPNAARALNNSLPNSNSSSVPPEERYAEQLIQLNDMGFWDPQKNIRALLSTGGNVNAAVE 404 Query: 140 LLLSD 126 +LLSD Sbjct: 405 MLLSD 409 >ref|XP_023463993.1| ubiquitin-domain-containing protein [Rhizopus microsporus ATCC 52813] gb|ORE10617.1| ubiquitin-domain-containing protein [Rhizopus microsporus var. microsporus] gb|PHZ10285.1| ubiquitin-domain-containing protein [Rhizopus microsporus ATCC 52813] Length = 328 Score = 72.0 bits (175), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL+A+GGNVNAAIELL S Sbjct: 286 RFQVQLQQLNEMGFWDAAKNIRALIATGGNVNAAIELLFS 325 >gb|PKY49967.1| hypothetical protein RhiirA4_323771 [Rhizophagus irregularis] Length = 358 Score = 71.6 bits (174), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD QKNIRALLA GGNV AAIE LLS Sbjct: 316 RFQVQLQQLNEMGFWDAQKNIRALLACGGNVQAAIEYLLS 355 >gb|PKY28269.1| hypothetical protein RhiirB3_444355 [Rhizophagus irregularis] Length = 358 Score = 71.6 bits (174), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD QKNIRALLA GGNV AAIE LLS Sbjct: 316 RFQVQLQQLNEMGFWDAQKNIRALLACGGNVQAAIEYLLS 355 >dbj|GBC23567.1| Nuclear-enriched ubiquitin-like polyubiquitin-binding protein Dsk2p [Rhizophagus irregularis DAOM 181602] gb|PKC17674.1| hypothetical protein RhiirA5_368836 [Rhizophagus irregularis] gb|PKC67021.1| hypothetical protein RhiirA1_458961 [Rhizophagus irregularis] gb|POG78189.1| hypothetical protein GLOIN_2v1539895 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 358 Score = 71.6 bits (174), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD QKNIRALLA GGNV AAIE LLS Sbjct: 316 RFQVQLQQLNEMGFWDAQKNIRALLACGGNVQAAIEYLLS 355 >emb|CEJ02938.1| Putative Ubiquitin-domain-containing protein [Rhizopus microsporus] Length = 298 Score = 70.9 bits (172), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIELL S Sbjct: 256 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIELLFS 295 >gb|ORX81711.1| hypothetical protein K493DRAFT_320600 [Basidiobolus meristosporus CBS 931.73] Length = 356 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLSD 126 RFQVQLQQLN+MGFWD KNIRALLA+GGNVN+A+E LLS+ Sbjct: 315 RFQVQLQQLNEMGFWDASKNIRALLATGGNVNSAVEWLLSN 355 >gb|KFH64062.1| hypothetical protein MVEG_09887 [Mortierella verticillata NRRL 6337] Length = 375 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRALLA+GGNVN AIELL S Sbjct: 333 RFQVQLQQLNEMGFWDAAKNIRALLAAGGNVNGAIELLFS 372 >gb|EIE85678.1| hypothetical protein RO3G_10388 [Rhizopus delemar RA 99-880] Length = 316 Score = 70.9 bits (172), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIELL S Sbjct: 274 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIELLFS 313 >emb|CEG72117.1| Putative Ubiquitin-domain-containing protein [Rhizopus microsporus] Length = 331 Score = 70.9 bits (172), Expect = 3e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIELL S Sbjct: 289 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIELLFS 328 >gb|ORE19701.1| ubiquitin-domain-containing protein [Rhizopus microsporus] Length = 505 Score = 70.9 bits (172), Expect = 4e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIELL S Sbjct: 463 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIELLFS 502 >gb|OAD05611.1| hypothetical protein MUCCIDRAFT_155946 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 353 Score = 70.1 bits (170), Expect = 5e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L S Sbjct: 311 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIEMLFS 350 >gb|EPB91035.1| hypothetical protein HMPREF1544_02104 [Mucor circinelloides f. circinelloides 1006PhL] Length = 353 Score = 70.1 bits (170), Expect = 5e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L S Sbjct: 311 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIEMLFS 350 >dbj|GAN03914.1| conserved hypothetical protein [Mucor ambiguus] Length = 380 Score = 70.1 bits (170), Expect = 6e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L S Sbjct: 338 RFQVQLQQLNEMGFWDAAKNIRALTATGGNVNAAIEMLFS 377 >gb|OAQ36802.1| hypothetical protein K457DRAFT_131946 [Mortierella elongata AG-77] Length = 382 Score = 70.1 bits (170), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRALLA+GGNV+AAIE+L S Sbjct: 340 RFQVQLQQLNEMGFWDAAKNIRALLAAGGNVHAAIEMLFS 379 >gb|OMJ13510.1| Ubiquitin domain-containing protein DSK2 [Smittium culicis] Length = 392 Score = 70.1 bits (170), Expect = 6e-11 Identities = 36/65 (55%), Positives = 43/65 (66%) Frame = -2 Query: 320 DPSFLYGLGNLGXXXXXXXXXXXERFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIE 141 DP+ L N ER+ QL QLN+MGFWDPQKNI ALL++GGNVNAA+E Sbjct: 327 DPNAARALNNPSVNSSSPSVPPEERYAEQLVQLNEMGFWDPQKNILALLSTGGNVNAAVE 386 Query: 140 LLLSD 126 +LLSD Sbjct: 387 MLLSD 391 >emb|SAM01852.1| hypothetical protein [Absidia glauca] Length = 362 Score = 69.7 bits (169), Expect = 7e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L S Sbjct: 320 RFQVQLQQLNEMGFWDAAKNIRALQATGGNVNAAIEMLFS 359 >gb|ORY99738.1| hypothetical protein BCR42DRAFT_457471 [Absidia repens] Length = 389 Score = 69.7 bits (169), Expect = 8e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 248 RFQVQLQQLNDMGFWDPQKNIRALLASGGNVNAAIELLLS 129 RFQVQLQQLN+MGFWD KNIRAL A+GGNVNAAIE+L S Sbjct: 347 RFQVQLQQLNEMGFWDAAKNIRALQATGGNVNAAIEMLFS 386