BLASTX nr result
ID: Ophiopogon25_contig00042705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00042705 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX67347.1| hypothetical protein RirG_115160 [Rhizophagus irr... 259 1e-85 gb|PKY39529.1| hypothetical protein RhiirA4_393591 [Rhizophagus ... 257 5e-85 >gb|EXX67347.1| hypothetical protein RirG_115160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC44384.1| adenine nucleotide alpha hydrolases-like protein [Rhizophagus irregularis DAOM 181602] gb|PKC12299.1| hypothetical protein RhiirA5_497039 [Rhizophagus irregularis] gb|PKC73271.1| hypothetical protein RhiirA1_530550 [Rhizophagus irregularis] gb|PKK64359.1| hypothetical protein RhiirC2_854374 [Rhizophagus irregularis] gb|PKY13312.1| hypothetical protein RhiirB3_465308 [Rhizophagus irregularis] gb|POG57668.1| hypothetical protein GLOIN_2v1849136 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 239 Score = 259 bits (661), Expect = 1e-85 Identities = 126/129 (97%), Positives = 128/129 (99%) Frame = +2 Query: 2 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVLQAQRLYY 181 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVL AQRLYY Sbjct: 3 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVLHAQRLYY 62 Query: 182 PVIDVWTFGLVGYANTYSTTSNHDEYQEYLKNEQEHAKNTLKNIASELKVKNVTSNIIIS 361 PVIDVWTFGLVGYANTY+TTSNHDEYQEYLKNEQEHAKNTLKN+ASELKVKNVTSNIIIS Sbjct: 63 PVIDVWTFGLVGYANTYNTTSNHDEYQEYLKNEQEHAKNTLKNVASELKVKNVTSNIIIS 122 Query: 362 RGNVREELL 388 RGNVREELL Sbjct: 123 RGNVREELL 131 >gb|PKY39529.1| hypothetical protein RhiirA4_393591 [Rhizophagus irregularis] Length = 238 Score = 257 bits (656), Expect = 5e-85 Identities = 125/129 (96%), Positives = 128/129 (99%) Frame = +2 Query: 2 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVLQAQRLYY 181 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVL AQRLYY Sbjct: 3 SLEKEIAKCDYRRRTILLAYDPDCITKSQELLEWAVTNVIRPNLDHVYIFSVLHAQRLYY 62 Query: 182 PVIDVWTFGLVGYANTYSTTSNHDEYQEYLKNEQEHAKNTLKNIASELKVKNVTSNIIIS 361 PVIDVWTFGLVGYANTY+TTSNHDEYQEYLKNEQEHAK+TLKN+ASELKVKNVTSNIIIS Sbjct: 63 PVIDVWTFGLVGYANTYNTTSNHDEYQEYLKNEQEHAKHTLKNVASELKVKNVTSNIIIS 122 Query: 362 RGNVREELL 388 RGNVREELL Sbjct: 123 RGNVREELL 131