BLASTX nr result
ID: Ophiopogon25_contig00042559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00042559 (1900 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC48623.1| negative regulation of gluconeogenesis-related p... 64 1e-06 >dbj|GBC48623.1| negative regulation of gluconeogenesis-related protein [Rhizophagus irregularis DAOM 181602] Length = 682 Score = 63.5 bits (153), Expect = 1e-06 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -1 Query: 1351 TLLSNFDEDQVPLPYSFAXXXXXXXXXXXXXSFPTDELRSQTSGYH 1214 TLLSNFDEDQVPLP+SFA SFPTDELRSQTSGYH Sbjct: 56 TLLSNFDEDQVPLPFSFASSSHITSPSNSSSSFPTDELRSQTSGYH 101