BLASTX nr result
ID: Ophiopogon25_contig00042214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00042214 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX55311.1| hypothetical protein RirG_226440 [Rhizophagus irr... 134 2e-37 >gb|EXX55311.1| hypothetical protein RirG_226440 [Rhizophagus irregularis DAOM 197198w] gb|EXX55312.1| hypothetical protein RirG_226440 [Rhizophagus irregularis DAOM 197198w] dbj|GBC42679.1| hypothetical protein RIR_2583400 [Rhizophagus irregularis DAOM 181602] gb|PKC05440.1| hypothetical protein RhiirA5_361321 [Rhizophagus irregularis] gb|PKC56753.1| hypothetical protein RhiirA1_428931 [Rhizophagus irregularis] gb|PKK59478.1| hypothetical protein RhiirC2_762629 [Rhizophagus irregularis] gb|PKY28738.1| hypothetical protein RhiirB3_417350 [Rhizophagus irregularis] gb|PKY46417.1| hypothetical protein RhiirA4_402475 [Rhizophagus irregularis] gb|POG69369.1| hypothetical protein GLOIN_2v1627940 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 184 Score = 134 bits (337), Expect = 2e-37 Identities = 73/106 (68%), Positives = 73/106 (68%) Frame = -2 Query: 349 LKNFMKAKDLKVVISYPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNGDAATDNPPTE 170 LKNFMKAKDLKVVISY KNGDAATDNPPTE Sbjct: 76 LKNFMKAKDLKVVISYSSTEKEEEHEESSSKKDVEDEKDKTDEEETTKNGDAATDNPPTE 135 Query: 169 NEPLYTLIAKPQKSYGWSAAIPKAKIKVEIDGEEVELPVSINLNIS 32 NEPLYTLIAKPQKSYGWSAA PKAKIKVEIDGEEVELPVSIN NIS Sbjct: 136 NEPLYTLIAKPQKSYGWSAAAPKAKIKVEIDGEEVELPVSINFNIS 181