BLASTX nr result
ID: Ophiopogon25_contig00042025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00042025 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63505.1| hypothetical protein RirG_151740 [Rhizophagus irr... 56 4e-07 >gb|EXX63505.1| hypothetical protein RirG_151740 [Rhizophagus irregularis DAOM 197198w] dbj|GBC24050.1| JEMT01023923.1_cds_EXX63505.1_16530 [Rhizophagus irregularis DAOM 181602] Length = 86 Score = 55.8 bits (133), Expect = 4e-07 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -3 Query: 375 VEWWIPRCKLTVQWEVSKGIDRTIKRSKN--ESGKQPKVVXXXXXXXXXNSDDIKVYDDL 202 +EWW+P+C+LT+QWEVS+GIDR +K S N S K+P V DDI+VY+ L Sbjct: 28 MEWWLPKCELTIQWEVSQGIDR-MKSSNNGSSSSKKPTAVNNRNIHNL---DDIEVYEGL 83