BLASTX nr result
ID: Ophiopogon25_contig00041965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041965 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX60950.1| hypothetical protein RirG_175340 [Rhizophagus irr... 59 4e-09 gb|PKC04412.1| hypothetical protein RhiirA5_422288 [Rhizophagus ... 57 2e-08 gb|PKY57663.1| hypothetical protein RhiirA4_478872 [Rhizophagus ... 56 7e-08 gb|POG58574.1| kinase-like domain-containing protein [Rhizophagu... 59 1e-07 dbj|GBC47123.1| hypothetical protein RIR_2940200 [Rhizophagus ir... 54 3e-07 gb|PKC08434.1| hypothetical protein RhiirA5_499975 [Rhizophagus ... 53 1e-06 >gb|EXX60950.1| hypothetical protein RirG_175340 [Rhizophagus irregularis DAOM 197198w] dbj|GBC24794.1| hypothetical protein RIR_1137900 [Rhizophagus irregularis DAOM 181602] Length = 74 Score = 58.9 bits (141), Expect = 4e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 352 MKFKCLLLIFVFTIVLADATPAAFKRDADAEAQ 254 MKFKCLLLIF FTIVLADA P + KRDADAEAQ Sbjct: 1 MKFKCLLLIFAFTIVLADAVPGSLKRDADAEAQ 33 >gb|PKC04412.1| hypothetical protein RhiirA5_422288 [Rhizophagus irregularis] gb|PKC60594.1| hypothetical protein RhiirA1_467821 [Rhizophagus irregularis] gb|PKY23221.1| hypothetical protein RhiirB3_437366 [Rhizophagus irregularis] Length = 74 Score = 57.4 bits (137), Expect = 2e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 352 MKFKCLLLIFVFTIVLADATPAAFKRDADAEAQ 254 MKFKCLLLIF FTIVLADA P + KRDADAE Q Sbjct: 1 MKFKCLLLIFAFTIVLADAVPGSLKRDADAETQ 33 >gb|PKY57663.1| hypothetical protein RhiirA4_478872 [Rhizophagus irregularis] Length = 81 Score = 55.8 bits (133), Expect = 7e-08 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -3 Query: 352 MKFKCLLLIFVFTIVLADATPAAFKRDADAEAQGSTAVSGTHGPPLKRISDAK*Q 188 MKFKCLLLIF FTIVLA+A P +FKRDADAEA PP KR DA+ Q Sbjct: 1 MKFKCLLLIFAFTIVLANAAP-SFKRDADAEAH----------PPRKRDVDAEAQ 44 >gb|POG58574.1| kinase-like domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 368 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 352 MKFKCLLLIFVFTIVLADATPAAFKRDADAEAQ 254 MKFKCLLLIF FTIVLADA P + KRDADAEAQ Sbjct: 1 MKFKCLLLIFAFTIVLADAVPGSLKRDADAEAQ 33 >dbj|GBC47123.1| hypothetical protein RIR_2940200 [Rhizophagus irregularis DAOM 181602] gb|POG83001.1| hypothetical protein GLOIN_2v382093 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 80 Score = 54.3 bits (129), Expect = 3e-07 Identities = 29/36 (80%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -3 Query: 361 KSIMKFKCLLLIFVFTIVLADATPA-AFKRDADAEA 257 KSIMKFKCLLLIF FTIVLA+A P KRDADAEA Sbjct: 5 KSIMKFKCLLLIFAFTIVLAEAYPPWGLKRDADAEA 40 >gb|PKC08434.1| hypothetical protein RhiirA5_499975 [Rhizophagus irregularis] Length = 80 Score = 52.8 bits (125), Expect = 1e-06 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -3 Query: 361 KSIMKFKCLLLIFVFTIVLADATPA-AFKRDADAEA 257 KSIMKFKCLLLIF FTIVLA+A P KRDA+AEA Sbjct: 5 KSIMKFKCLLLIFAFTIVLAEAYPPWGLKRDAEAEA 40