BLASTX nr result
ID: Ophiopogon25_contig00041964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041964 (682 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX79481.1| hypothetical protein RirG_005160 [Rhizophagus irr... 207 7e-66 >gb|EXX79481.1| hypothetical protein RirG_005160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC38472.1| hypothetical protein RIR_2239200 [Rhizophagus irregularis DAOM 181602] Length = 101 Score = 207 bits (528), Expect = 7e-66 Identities = 100/101 (99%), Positives = 101/101 (100%) Frame = +1 Query: 205 MCDVQVFAPHKPDFENYYYFAINLITRVIPEPSPATYLQGLSQRVPELEYLGPVGHLDDA 384 MCDVQVFAPHKPDFENYYYFAINLITRVIPEPSPATYLQGLSQR+PELEYLGPVGHLDDA Sbjct: 1 MCDVQVFAPHKPDFENYYYFAINLITRVIPEPSPATYLQGLSQRIPELEYLGPVGHLDDA 60 Query: 385 VQVRVKKSEEIDIDGLIDGFETIKGVESAELQSPKFRNRRN 507 VQVRVKKSEEIDIDGLIDGFETIKGVESAELQSPKFRNRRN Sbjct: 61 VQVRVKKSEEIDIDGLIDGFETIKGVESAELQSPKFRNRRN 101