BLASTX nr result
ID: Ophiopogon25_contig00041782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041782 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX78641.1| Lsm6p [Rhizophagus irregularis DAOM 197198w] >gi|... 165 1e-50 gb|PKK77367.1| Sm-like ribonucleo protein [Rhizophagus irregularis] 147 1e-43 gb|ORX87428.1| Sm protein F-like protein [Basidiobolus meristosp... 138 5e-40 ref|XP_002117054.1| conserved hypothetical protein [Trichoplax a... 135 9e-39 ref|XP_005093648.1| PREDICTED: U6 snRNA-associated Sm-like prote... 135 1e-38 gb|ORX43233.1| hypothetical protein BCR36DRAFT_586726 [Piromyces... 134 2e-38 ref|XP_013782437.1| U6 snRNA-associated Sm-like protein LSm6 [Li... 134 3e-38 ref|XP_011425089.1| PREDICTED: U6 snRNA-associated Sm-like prote... 134 3e-38 gb|ORY73715.1| hypothetical protein LY90DRAFT_699472 [Neocallima... 134 3e-38 ref|XP_022330558.1| U6 snRNA-associated Sm-like protein LSm6 [Cr... 134 4e-38 ref|XP_015916346.1| U6 snRNA-associated Sm-like protein LSm6 [Pa... 134 4e-38 ref|XP_009059694.1| hypothetical protein LOTGIDRAFT_164944 [Lott... 133 5e-38 ref|XP_004456556.1| U6 snRNA-associated Sm-like protein LSm6 iso... 133 5e-38 ref|XP_012950315.1| U6 snRNA-associated Sm-like protein LSm6, pa... 133 7e-38 ref|NP_009011.1| U6 snRNA-associated Sm-like protein LSm6 [Homo ... 133 7e-38 ref|XP_005864923.1| PREDICTED: U6 snRNA-associated Sm-like prote... 133 7e-38 ref|XP_007897352.1| PREDICTED: U6 snRNA-associated Sm-like prote... 133 7e-38 ref|XP_005995598.1| PREDICTED: U6 snRNA-associated Sm-like prote... 133 8e-38 ref|XP_010609228.1| PREDICTED: U6 snRNA-associated Sm-like prote... 133 8e-38 ref|XP_005883121.1| PREDICTED: U6 snRNA-associated Sm-like prote... 132 1e-37 >gb|EXX78641.1| Lsm6p [Rhizophagus irregularis DAOM 197198w] dbj|GBC35043.1| U6 snRNA-associated Sm-like protein LSm6 [Rhizophagus irregularis DAOM 181602] gb|PKC17336.1| like-Sm ribonucleo protein [Rhizophagus irregularis] gb|PKC71186.1| like-Sm ribonucleo protein [Rhizophagus irregularis] gb|PKY13666.1| like-Sm ribonucleoprotein [Rhizophagus irregularis] gb|PKY38339.1| like-Sm ribonucleo protein [Rhizophagus irregularis] gb|POG78824.1| Sm-like protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 80 Score = 165 bits (418), Expect = 1e-50 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = -3 Query: 430 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 251 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK Sbjct: 1 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 60 Query: 250 YGDAFIRGNNVLYISADKSR 191 YGDAFIRGNNVLYISADKSR Sbjct: 61 YGDAFIRGNNVLYISADKSR 80 >gb|PKK77367.1| Sm-like ribonucleo protein [Rhizophagus irregularis] Length = 73 Score = 147 bits (371), Expect = 1e-43 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = -3 Query: 430 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 251 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK Sbjct: 1 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 60 Query: 250 YGDAFIRGNN 221 YGDAFIRGNN Sbjct: 61 YGDAFIRGNN 70 >gb|ORX87428.1| Sm protein F-like protein [Basidiobolus meristosporus CBS 931.73] Length = 79 Score = 138 bits (348), Expect = 5e-40 Identities = 65/78 (83%), Positives = 74/78 (94%) Frame = -3 Query: 430 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 251 M+ EK+P+EFLN++IGRPVLVKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNK Sbjct: 1 MEPSHEKSPSEFLNHIIGRPVLVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNK 60 Query: 250 YGDAFIRGNNVLYISADK 197 YGDAFIRGNNVLYIS+ K Sbjct: 61 YGDAFIRGNNVLYISSLK 78 >ref|XP_002117054.1| conserved hypothetical protein [Trichoplax adhaerens] gb|EDV20360.1| conserved hypothetical protein [Trichoplax adhaerens] Length = 79 Score = 135 bits (340), Expect = 9e-39 Identities = 63/76 (82%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP+EFL NVIGRPV+VKLNSGVDYRGIL+CLDGYMNIALEQTEE++NGQLKNKYGDA Sbjct: 3 KKQTPSEFLKNVIGRPVVVKLNSGVDYRGILTCLDGYMNIALEQTEEYINGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNV YIS K R Sbjct: 63 FIRGNNVFYISTQKRR 78 >ref|XP_005093648.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Aplysia californica] Length = 78 Score = 135 bits (339), Expect = 1e-38 Identities = 63/76 (82%), Positives = 70/76 (92%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 + +TP+EFLN + GRPV+VKLNSGVDYRG+LSCLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 3 RRQTPSEFLNQIRGRPVMVKLNSGVDYRGVLSCLDGYMNIALEQTEEYVNGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 63 FIRGNNVLYISTQKRR 78 >gb|ORX43233.1| hypothetical protein BCR36DRAFT_586726 [Piromyces finnis] Length = 75 Score = 134 bits (338), Expect = 2e-38 Identities = 63/72 (87%), Positives = 70/72 (97%) Frame = -3 Query: 412 KTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDAFI 233 KTPTEFL+NVIG+PV+VKLNSG+ Y+GIL+CLDGYMNIALEQTEE+VNGQLKNKYGDAFI Sbjct: 3 KTPTEFLDNVIGKPVIVKLNSGIKYQGILACLDGYMNIALEQTEEYVNGQLKNKYGDAFI 62 Query: 232 RGNNVLYISADK 197 RGNNVLYISA K Sbjct: 63 RGNNVLYISASK 74 >ref|XP_013782437.1| U6 snRNA-associated Sm-like protein LSm6 [Limulus polyphemus] ref|XP_013782438.1| U6 snRNA-associated Sm-like protein LSm6 [Limulus polyphemus] ref|XP_021358522.1| U6 snRNA-associated Sm-like protein LSm6 [Mizuhopecten yessoensis] ref|XP_021344353.1| U6 snRNA-associated Sm-like protein LSm6 [Mizuhopecten yessoensis] ref|XP_022250466.1| U6 snRNA-associated Sm-like protein LSm6 [Limulus polyphemus] Length = 79 Score = 134 bits (337), Expect = 3e-38 Identities = 62/76 (81%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP+EFL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 3 RKQTPSEFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 63 FIRGNNVLYISTQKRR 78 >ref|XP_011425089.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Crassostrea gigas] ref|XP_011420171.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Crassostrea gigas] ref|XP_011420172.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Crassostrea gigas] gb|EKC33791.1| U6 snRNA-associated Sm-like protein LSm6 [Crassostrea gigas] Length = 79 Score = 134 bits (337), Expect = 3e-38 Identities = 62/76 (81%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP+EFL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 3 RKQTPSEFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 63 FIRGNNVLYISTQKRR 78 >gb|ORY73715.1| hypothetical protein LY90DRAFT_699472 [Neocallimastix californiae] Length = 76 Score = 134 bits (336), Expect = 3e-38 Identities = 63/73 (86%), Positives = 71/73 (97%) Frame = -3 Query: 415 EKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDAF 236 +K+PTEFL+NVIG+PV+VKLNSGV Y+GIL+CLDGYMNIALEQTEE+VNGQLKNKYGDAF Sbjct: 3 KKSPTEFLDNVIGKPVIVKLNSGVKYQGILACLDGYMNIALEQTEEYVNGQLKNKYGDAF 62 Query: 235 IRGNNVLYISADK 197 IRGNNVLYISA K Sbjct: 63 IRGNNVLYISASK 75 >ref|XP_022330558.1| U6 snRNA-associated Sm-like protein LSm6 [Crassostrea virginica] ref|XP_022330823.1| U6 snRNA-associated Sm-like protein LSm6 [Crassostrea virginica] Length = 79 Score = 134 bits (336), Expect = 4e-38 Identities = 62/76 (81%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP+EFL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 3 RKQTPSEFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 63 FIRGNNVLYISTHKRR 78 >ref|XP_015916346.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] ref|XP_015916347.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] ref|XP_015916348.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] ref|XP_015916349.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] ref|XP_015916350.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] ref|XP_015916351.1| U6 snRNA-associated Sm-like protein LSm6 [Parasteatoda tepidariorum] Length = 79 Score = 134 bits (336), Expect = 4e-38 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 + +TP+EFL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 3 RRQTPSEFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 62 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 63 FIRGNNVLYISTQKRR 78 >ref|XP_009059694.1| hypothetical protein LOTGIDRAFT_164944 [Lottia gigantea] gb|ESO89640.1| hypothetical protein LOTGIDRAFT_164944 [Lottia gigantea] Length = 79 Score = 133 bits (335), Expect = 5e-38 Identities = 64/80 (80%), Positives = 72/80 (90%) Frame = -3 Query: 430 MQNQQEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNK 251 M N+Q TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNK Sbjct: 1 MSNKQ--TPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNK 58 Query: 250 YGDAFIRGNNVLYISADKSR 191 YGDAFIRGNNVLYIS K R Sbjct: 59 YGDAFIRGNNVLYISTQKRR 78 >ref|XP_004456556.1| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Dasypus novemcinctus] ref|XP_004456557.1| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Dasypus novemcinctus] ref|XP_004456558.1| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Dasypus novemcinctus] ref|XP_023444016.1| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Dasypus novemcinctus] Length = 80 Score = 133 bits (335), Expect = 5e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 64 FIRGNNVLYISTQKKR 79 >ref|XP_012950315.1| U6 snRNA-associated Sm-like protein LSm6, partial [Anas platyrhynchos] Length = 77 Score = 133 bits (334), Expect = 7e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 1 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 60 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 61 FIRGNNVLYISTQKRR 76 >ref|NP_009011.1| U6 snRNA-associated Sm-like protein LSm6 [Homo sapiens] ref|NP_084421.1| U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] ref|NP_001087318.1| Sm protein F [Xenopus laevis] ref|NP_001107991.1| U6 snRNA-associated Sm-like protein LSm6 [Bos taurus] ref|NP_001119557.1| U6 snRNA-associated Sm-like protein LSm6 [Rattus norvegicus] ref|NP_001165068.1| U6 snRNA-associated Sm-like protein LSm6 [Xenopus tropicalis] ref|NP_001177933.1| U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] ref|NP_001232484.1| U6 snRNA-associated Sm-like protein LSm6 [Taeniopygia guttata] ref|NP_001253894.1| U6 snRNA-associated Sm-like protein LSm6 [Macaca mulatta] ref|NP_001289054.1| U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Gallus gallus] ref|NP_001289055.1| U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Gallus gallus] ref|XP_001510547.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ornithorhynchus anatinus] ref|XP_002716966.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_002745354.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Callithrix jacchus] ref|XP_002916283.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ailuropoda melanoleuca] ref|XP_003205470.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Meleagris gallopavo] ref|XP_003221741.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_003257824.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nomascus leucogenys] ref|XP_003257825.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nomascus leucogenys] ref|XP_003310523.1| U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] ref|XP_003339112.1| U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] ref|XP_003357054.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Sus scrofa] ref|XP_003364554.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Equus caballus] ref|XP_003417595.1| U6 snRNA-associated Sm-like protein LSm6 [Loxodonta africana] ref|XP_855162.2| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Canis lupus familiaris] ref|XP_003432092.1| U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Canis lupus familiaris] ref|XP_003476889.1| U6 snRNA-associated Sm-like protein LSm6 [Cavia porcellus] ref|XP_003500806.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cricetulus griseus] ref|XP_003773202.1| U6 snRNA-associated Sm-like protein LSm6 [Sarcophilus harrisii] ref|XP_003790249.1| U6 snRNA-associated Sm-like protein LSm6 [Otolemur garnettii] ref|XP_003899290.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_003985017.1| U6 snRNA-associated Sm-like protein LSm6 [Felis catus] ref|XP_004017265.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ovis aries] ref|XP_004040503.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_004040505.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_004088560.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nomascus leucogenys] ref|XP_004263659.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Orcinus orca] ref|XP_004263660.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Orcinus orca] ref|XP_004378901.1| U6 snRNA-associated Sm-like protein LSm6 [Trichechus manatus latirostris] ref|XP_004411815.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Odobenus rosmarus divergens] ref|XP_004420944.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ceratotherium simum simum] ref|XP_004606250.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Sorex araneus] ref|XP_004655900.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Jaculus jaculus] ref|XP_004708757.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Echinops telfairi] ref|XP_004758073.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Mustela putorius furo] ref|XP_004758074.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Mustela putorius furo] ref|XP_004868978.1| U6 snRNA-associated Sm-like protein LSm6 isoform X6 [Heterocephalus glaber] ref|XP_005006841.1| U6 snRNA-associated Sm-like protein LSm6 [Cavia porcellus] ref|XP_005077791.1| U6 snRNA-associated Sm-like protein LSm6 [Mesocricetus auratus] ref|XP_005146622.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Melopsittacus undulatus] ref|XP_005284337.1| U6 snRNA-associated Sm-like protein LSm6 [Chrysemys picta bellii] ref|XP_005284338.1| U6 snRNA-associated Sm-like protein LSm6 [Chrysemys picta bellii] ref|XP_005345438.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Microtus ochrogaster] ref|XP_005345439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Microtus ochrogaster] ref|XP_005345440.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Microtus ochrogaster] ref|XP_005327601.1| U6 snRNA-associated Sm-like protein LSm6 [Ictidomys tridecemlineatus] ref|XP_005386718.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chinchilla lanigera] ref|XP_005386719.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chinchilla lanigera] ref|XP_005485374.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Zonotrichia albicollis] ref|XP_005418158.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Geospiza fortis] ref|XP_005525655.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pseudopodoces humilis] ref|XP_005499923.1| U6 snRNA-associated Sm-like protein LSm6 [Columba livia] ref|XP_005556078.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca fascicularis] ref|XP_005556079.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca fascicularis] ref|XP_005556081.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca fascicularis] ref|XP_005666900.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Sus scrofa] ref|XP_005666901.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Sus scrofa] ref|XP_005666903.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Sus scrofa] ref|XP_005691262.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Capra hircus] ref|XP_005975471.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Pantholops hodgsonii] ref|XP_005975472.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Pantholops hodgsonii] ref|XP_005995599.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Latimeria chalumnae] ref|XP_005995600.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Latimeria chalumnae] ref|XP_005995601.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Latimeria chalumnae] ref|XP_006023780.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Alligator sinensis] ref|XP_006081812.1| U6 snRNA-associated Sm-like protein LSm6 [Myotis lucifugus] ref|XP_006081813.1| U6 snRNA-associated Sm-like protein LSm6 [Myotis lucifugus] ref|XP_006133902.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pelodiscus sinensis] ref|XP_006187285.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus ferus] ref|XP_006143521.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Tupaia chinensis] ref|XP_006143522.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Tupaia chinensis] ref|XP_006268590.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Alligator mississippiensis] ref|XP_006255470.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Rattus norvegicus] ref|XP_006755821.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Myotis davidii] ref|XP_006751607.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X1 [Leptonychotes weddellii] ref|XP_006751608.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X2 [Leptonychotes weddellii] ref|XP_006887063.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Elephantulus edwardii] ref|XP_006872338.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chrysochloris asiatica] ref|XP_006906345.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pteropus alecto] ref|XP_006930901.1| U6 snRNA-associated Sm-like protein LSm6 [Felis catus] ref|XP_006971787.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Peromyscus maniculatus bairdii] ref|XP_007091822.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Panthera tigris altaica] ref|XP_007091823.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Panthera tigris altaica] ref|XP_007055771.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chelonia mydas] ref|XP_007120814.1| U6 snRNA-associated Sm-like protein LSm6 [Physeter catodon] ref|XP_007120815.1| U6 snRNA-associated Sm-like protein LSm6 [Physeter catodon] ref|XP_006065774.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Bubalus bubalis] ref|XP_006065775.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Bubalus bubalis] ref|XP_007189439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Balaenoptera acutorostrata scammoni] ref|XP_007189440.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Balaenoptera acutorostrata scammoni] ref|XP_007189441.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Balaenoptera acutorostrata scammoni] ref|XP_007189442.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Balaenoptera acutorostrata scammoni] ref|XP_007433786.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Python bivittatus] ref|XP_007433787.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Python bivittatus] ref|XP_007472061.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Lipotes vexillifer] ref|XP_001376922.3| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Monodelphis domestica] ref|XP_007528283.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Erinaceus europaeus] ref|XP_007942303.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Orycteropus afer afer] ref|XP_007998111.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chlorocebus sabaeus] ref|XP_007998112.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chlorocebus sabaeus] ref|XP_008110230.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_008110231.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_008051438.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Carlito syrichta] ref|XP_008142118.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Eptesicus fuscus] ref|XP_008265603.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_008265604.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_008265605.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_008265606.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_008265607.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Oryctolagus cuniculus] ref|XP_008499011.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Calypte anna] ref|XP_008530194.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Equus przewalskii] ref|XP_008587468.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Galeopterus variegatus] ref|XP_008587469.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Galeopterus variegatus] ref|XP_008587470.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Galeopterus variegatus] ref|XP_008587471.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Galeopterus variegatus] ref|XP_008639496.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Corvus brachyrhynchos] ref|XP_008683670.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ursus maritimus] ref|XP_008683671.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ursus maritimus] ref|XP_008825694.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nannospalax galili] ref|XP_008825695.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nannospalax galili] ref|XP_008935380.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Merops nubicus] ref|XP_008990872.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Callithrix jacchus] ref|XP_008990873.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Callithrix jacchus] ref|XP_008967118.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan paniscus] ref|XP_008967119.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan paniscus] ref|XP_008967120.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan paniscus] ref|XP_008967121.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan paniscus] ref|XP_009069390.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Acanthisitta chloris] ref|XP_009205922.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_009238633.1| U6 snRNA-associated Sm-like protein LSm6 [Pongo abelii] ref|XP_009327016.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pygoscelis adeliae] ref|XP_009446666.1| U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] ref|XP_009568566.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cuculus canorus] ref|XP_009687554.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Struthio camelus australis] ref|XP_009815918.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gavia stellata] ref|XP_010021586.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nestor notabilis] ref|XP_010007241.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chaetura pelagica] ref|XP_009987241.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Tauraco erythrolophus] ref|XP_010134441.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Buceros rhinoceros silvestris] ref|XP_010076616.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pterocles gutturalis] ref|XP_010123534.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chlamydotis macqueenii] ref|XP_010290878.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Phaethon lepturus] ref|XP_010310459.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Balearica regulorum gibbericeps] ref|XP_010359639.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus roxellana] ref|XP_010359646.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus roxellana] ref|XP_010359653.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus roxellana] ref|XP_010359660.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus roxellana] ref|XP_010336926.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Saimiri boliviensis boliviensis] ref|XP_010410297.1| U6 snRNA-associated Sm-like protein LSm6 [Corvus cornix cornix] ref|XP_010609231.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Fukomys damarensis] ref|XP_010595514.1| U6 snRNA-associated Sm-like protein LSm6 [Loxodonta africana] ref|XP_010841982.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Bison bison bison] ref|XP_010952880.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus bactrianus] ref|XP_010952881.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus bactrianus] ref|XP_010980957.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus dromedarius] ref|XP_010980958.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus dromedarius] ref|XP_011357714.1| U6 snRNA-associated Sm-like protein LSm6 [Pteropus vampyrus] ref|XP_011591159.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Aquila chrysaetos canadensis] ref|XP_011591161.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Aquila chrysaetos canadensis] ref|XP_011812234.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Colobus angolensis palliatus] ref|XP_011812240.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Colobus angolensis palliatus] ref|XP_011812246.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Colobus angolensis palliatus] ref|XP_011842517.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Mandrillus leucophaeus] ref|XP_011842518.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Mandrillus leucophaeus] ref|XP_011804983.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Colobus angolensis palliatus] ref|XP_011708795.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca nemestrina] ref|XP_011708796.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca nemestrina] ref|XP_011708797.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca nemestrina] ref|XP_011708798.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca nemestrina] ref|XP_011708799.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca nemestrina] ref|XP_011904521.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011904523.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011904524.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011904525.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011904526.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011904527.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cercocebus atys] ref|XP_011988422.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ovis aries musimon] ref|XP_012309434.1| U6 snRNA-associated Sm-like protein LSm6 [Aotus nancymaae] ref|XP_012309435.1| U6 snRNA-associated Sm-like protein LSm6 [Aotus nancymaae] ref|XP_012391255.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Orcinus orca] ref|XP_012515490.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Propithecus coquereli] ref|XP_012515491.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Propithecus coquereli] ref|XP_012639221.1| U6 snRNA-associated Sm-like protein LSm6 [Microcebus murinus] ref|XP_012639223.1| U6 snRNA-associated Sm-like protein LSm6 [Microcebus murinus] ref|XP_012666579.1| U6 snRNA-associated Sm-like protein LSm6 [Otolemur garnettii] ref|XP_012820463.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Xenopus tropicalis] ref|XP_012820468.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Xenopus tropicalis] ref|XP_012884970.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Dipodomys ordii] ref|XP_012884971.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Dipodomys ordii] ref|XP_012884972.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Dipodomys ordii] ref|XP_012974317.1| U6 snRNA-associated Sm-like protein LSm6 [Mesocricetus auratus] ref|XP_012974319.1| U6 snRNA-associated Sm-like protein LSm6 [Mesocricetus auratus] ref|XP_013030543.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anser cygnoides domesticus] ref|XP_013215127.1| U6 snRNA-associated Sm-like protein LSm6 [Ictidomys tridecemlineatus] ref|XP_013807034.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Apteryx australis mantelli] ref|XP_013914824.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Thamnophis sirtalis] ref|XP_014311129.1| U6 snRNA-associated Sm-like protein LSm6 [Myotis lucifugus] ref|XP_014343653.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Latimeria chalumnae] ref|XP_014375500.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Alligator sinensis] ref|XP_014375502.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Alligator sinensis] ref|XP_014693619.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Equus asinus] ref|XP_014736091.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Sturnus vulgaris] ref|XP_014805279.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Calidris pugnax] ref|XP_014937073.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Acinonyx jubatus] ref|XP_014937079.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Acinonyx jubatus] ref|XP_014994764.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Macaca mulatta] ref|XP_014994765.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Macaca mulatta] ref|XP_014994766.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Macaca mulatta] ref|XP_015099636.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Vicugna pacos] ref|XP_015099637.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Vicugna pacos] ref|XP_015278416.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015278417.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015278418.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015278419.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015278420.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015278421.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gekko japonicus] ref|XP_015306369.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Macaca fascicularis] ref|XP_015339937.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Marmota marmota marmota] ref|XP_015397405.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Panthera tigris altaica] ref|XP_015480055.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Parus major] ref|XP_015670009.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Protobothrops mucrosquamatus] ref|XP_015670010.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Protobothrops mucrosquamatus] ref|XP_015716653.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Coturnix japonica] ref|XP_016019550.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rousettus aegyptiacus] ref|XP_016019551.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rousettus aegyptiacus] ref|XP_016019552.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rousettus aegyptiacus] ref|XP_016045859.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Erinaceus europaeus] ref|XP_016062383.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Miniopterus natalensis] ref|XP_016062384.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Miniopterus natalensis] ref|XP_016062385.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Miniopterus natalensis] ref|XP_016153183.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Ficedula albicollis] ref|XP_016153184.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Ficedula albicollis] ref|XP_016830292.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cricetulus griseus] ref|XP_016827307.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cricetulus griseus] ref|XP_016849584.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_016849585.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_016849586.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Anolis carolinensis] ref|XP_016807823.1| U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] ref|XP_016863161.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Homo sapiens] ref|XP_016863162.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Homo sapiens] ref|XP_017390276.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Cebus capucinus imitator] ref|XP_017460079.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rattus norvegicus] ref|XP_017454452.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rattus norvegicus] ref|XP_017675640.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Lepidothrix coronata] ref|XP_017675641.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Lepidothrix coronata] ref|XP_017736987.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus bieti] ref|XP_017736988.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus bieti] ref|XP_017736989.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus bieti] ref|XP_017736990.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus bieti] ref|XP_017736991.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinopithecus bieti] ref|XP_017814589.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_017814590.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_017825704.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Callithrix jacchus] ref|XP_017929028.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Manacus vitellinus] ref|XP_017949809.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Xenopus tropicalis] ref|XP_018087015.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Xenopus laevis] ref|XP_018408487.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nanorana parkeri] ref|XP_018880463.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_018880464.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_018880466.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_018880467.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_018880468.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_018880469.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gorilla gorilla gorilla] ref|XP_019276299.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Panthera pardus] ref|XP_019276310.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Panthera pardus] ref|XP_019377706.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Gavialis gangeticus] ref|XP_019389983.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Crocodylus porosus] ref|XP_019517607.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Hipposideros armiger] ref|XP_019517608.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Hipposideros armiger] ref|XP_019470049.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Meleagris gallopavo] ref|XP_019586298.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019586299.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019586300.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019586301.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019586302.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019586303.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Rhinolophus sinicus] ref|XP_019782103.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Tursiops truncatus] ref|XP_019782104.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Tursiops truncatus] ref|XP_019833517.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Bos indicus] ref|XP_020027543.1| U6 snRNA-associated Sm-like protein LSm6 [Castor canadensis] ref|XP_020027613.1| U6 snRNA-associated Sm-like protein LSm6 [Castor canadensis] ref|XP_020027684.1| U6 snRNA-associated Sm-like protein LSm6 [Castor canadensis] ref|XP_020638646.1| U6 snRNA-associated Sm-like protein LSm6 [Pogona vitticeps] ref|XP_020638647.1| U6 snRNA-associated Sm-like protein LSm6 [Pogona vitticeps] ref|XP_020638648.1| U6 snRNA-associated Sm-like protein LSm6 [Pogona vitticeps] ref|XP_020756926.1| U6 snRNA-associated Sm-like protein LSm6 [Odocoileus virginianus texanus] ref|XP_020833962.1| U6 snRNA-associated Sm-like protein LSm6 [Phascolarctos cinereus] ref|XP_020833963.1| U6 snRNA-associated Sm-like protein LSm6 [Phascolarctos cinereus] ref|XP_020957193.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Sus scrofa] ref|XP_021076091.1| U6 snRNA-associated Sm-like protein LSm6 [Mus pahari] ref|XP_021076092.1| U6 snRNA-associated Sm-like protein LSm6 [Mus pahari] ref|XP_021026071.1| U6 snRNA-associated Sm-like protein LSm6 [Mus caroli] ref|XP_021026072.1| U6 snRNA-associated Sm-like protein LSm6 [Mus caroli] ref|XP_021139718.1| U6 snRNA-associated Sm-like protein LSm6 [Columba livia] ref|XP_021251152.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Numida meleagris] ref|XP_021251153.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Numida meleagris] ref|XP_021404898.1| U6 snRNA-associated Sm-like protein LSm6 [Lonchura striata domestica] ref|XP_021404899.1| U6 snRNA-associated Sm-like protein LSm6 [Lonchura striata domestica] ref|XP_021404900.1| U6 snRNA-associated Sm-like protein LSm6 [Lonchura striata domestica] ref|XP_021500979.1| U6 snRNA-associated Sm-like protein LSm6 [Meriones unguiculatus] ref|XP_021500981.1| U6 snRNA-associated Sm-like protein LSm6 [Meriones unguiculatus] ref|XP_021534985.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Neomonachus schauinslandi] ref|XP_021534986.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Neomonachus schauinslandi] ref|XP_021565741.1| U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Carlito syrichta] ref|XP_021794527.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_021794528.1| U6 snRNA-associated Sm-like protein LSm6 [Papio anubis] ref|XP_022369809.1| U6 snRNA-associated Sm-like protein LSm6 [Enhydra lutris kenyoni] ref|XP_022369816.1| U6 snRNA-associated Sm-like protein LSm6 [Enhydra lutris kenyoni] ref|XP_022455381.1| U6 snRNA-associated Sm-like protein LSm6 [Delphinapterus leucas] ref|XP_022455382.1| U6 snRNA-associated Sm-like protein LSm6 [Delphinapterus leucas] ref|XP_022455383.1| U6 snRNA-associated Sm-like protein LSm6 [Delphinapterus leucas] ref|XP_023082984.1| U6 snRNA-associated Sm-like protein LSm6 [Piliocolobus tephrosceles] ref|XP_023082991.1| U6 snRNA-associated Sm-like protein LSm6 [Piliocolobus tephrosceles] ref|XP_023082996.1| U6 snRNA-associated Sm-like protein LSm6 [Piliocolobus tephrosceles] ref|XP_023083005.1| U6 snRNA-associated Sm-like protein LSm6 [Piliocolobus tephrosceles] ref|XP_023369238.1| U6 snRNA-associated Sm-like protein LSm6 [Otolemur garnettii] ref|XP_023416096.1| U6 snRNA-associated Sm-like protein LSm6 [Cavia porcellus] ref|XP_023589347.1| U6 snRNA-associated Sm-like protein LSm6 [Trichechus manatus latirostris] ref|XP_023610645.1| U6 snRNA-associated Sm-like protein LSm6 [Myotis lucifugus] ref|XP_023782054.1| U6 snRNA-associated Sm-like protein LSm6 [Cyanistes caeruleus] ref|XP_023782055.1| U6 snRNA-associated Sm-like protein LSm6 [Cyanistes caeruleus] ref|XP_024102308.1| U6 snRNA-associated Sm-like protein LSm6 [Pongo abelii] ref|XP_024063369.1| U6 snRNA-associated Sm-like protein LSm6 [Terrapene mexicana triunguis] ref|XP_024063370.1| U6 snRNA-associated Sm-like protein LSm6 [Terrapene mexicana triunguis] ref|XP_024063371.1| U6 snRNA-associated Sm-like protein LSm6 [Terrapene mexicana triunguis] ref|XP_024063372.1| U6 snRNA-associated Sm-like protein LSm6 [Terrapene mexicana triunguis] sp|P62312.1|LSM6_HUMAN RecName: Full=U6 snRNA-associated Sm-like protein LSm6 sp|P62313.1|LSM6_MOUSE RecName: Full=U6 snRNA-associated Sm-like protein LSm6 pdb|3JCR|6 Chain 6, 3d Structure Determination Of The Human*u4/u6.u5* Tri-snrnp Complex pdb|5O9Z|SS Chain s, Cryo-em Structure Of A Pre-catalytic Human Spliceosome Primed For Activation (b Complex) gb|AAD56230.1|AF182292_1 U6 snRNA-associated Sm-like protein LSm6 [Homo sapiens] emb|CAB45869.1| Lsm6 protein [Homo sapiens] dbj|BAB31555.1| unnamed protein product [Mus musculus] gb|AAH16026.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Homo sapiens] gb|AAH30427.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Mus musculus] dbj|BAC37251.1| unnamed protein product [Mus musculus] gb|AAH78551.1| MGC85411 protein [Xenopus laevis] gb|AAY41032.1| unknown [Homo sapiens] gb|AAH98230.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Mus musculus] gb|AAH99484.1| Lsm6 protein [Mus musculus] dbj|BAE36530.1| unnamed protein product [Mus musculus] dbj|BAE34418.1| unnamed protein product [Mus musculus] dbj|BAE24870.1| unnamed protein product [Mus musculus] gb|AAI18349.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Bos taurus] gb|AAI18890.1| MGC147213 protein [Xenopus tropicalis] gb|AAI28976.1| MGC85411 protein [Xenopus laevis] gb|EAX05029.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gb|EAX05030.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gb|EAX05031.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gb|ABM83254.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [synthetic construct] gb|EDL10862.1| mCG7981, isoform CRA_a [Mus musculus] gb|EDL10864.1| mCG7981, isoform CRA_a [Mus musculus] gb|EDL92319.1| rCG51654, isoform CRA_a [Rattus norvegicus] gb|EDL92320.1| rCG51654, isoform CRA_a [Rattus norvegicus] gb|EDL92321.1| rCG51654, isoform CRA_a [Rattus norvegicus] gb|EDM09858.1| rCG63582, isoform CRA_b [Rattus norvegicus] gb|ABW03308.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), partial [synthetic construct] gb|AAI57145.1| MGC147213 protein [Xenopus tropicalis] dbj|BAG35062.1| unnamed protein product [Homo sapiens] gb|ACH43962.1| putative LSM6 homolog U6 small nuclear RNA associated [Taeniopygia guttata] dbj|BAI46569.1| U6 snRNA-associated Sm-like protein LSm6, partial [synthetic construct] tpg|DAA20897.1| TPA: Sm protein F [Bos taurus] gb|EGW00224.1| U6 snRNA-associated Sm-like protein LSm6 [Cricetulus griseus] gb|EHB17449.1| U6 snRNA-associated Sm-like protein LSm6 [Heterocephalus glaber] gb|EHH26224.1| hypothetical protein EGK_16139 [Macaca mulatta] gb|EHH61876.1| hypothetical protein EGM_20027 [Macaca fascicularis] gb|ELK17518.1| U6 snRNA-associated Sm-like protein LSm6 [Pteropus alecto] gb|EMP39664.1| U6 snRNA-associated Sm-like protein LSm6, partial [Chelonia mydas] gb|AIC50824.1| LSM6, partial [synthetic construct] gb|KFM08211.1| U6 snRNA-associated Sm-like LSm6 [Aptenodytes forsteri] gb|KFO03763.1| U6 snRNA-associated Sm-like LSm6 [Balearica regulorum gibbericeps] gb|KFO20581.1| U6 snRNA-associated Sm-like protein LSm6 [Fukomys damarensis] gb|KFO64893.1| U6 snRNA-associated Sm-like LSm6 [Corvus brachyrhynchos] gb|KFO70699.1| U6 snRNA-associated Sm-like LSm6 [Cuculus canorus] gb|KFO89736.1| U6 snRNA-associated Sm-like LSm6 [Buceros rhinoceros silvestris] gb|KFP06262.1| U6 snRNA-associated Sm-like LSm6 [Calypte anna] gb|KFP19945.1| U6 snRNA-associated Sm-like LSm6 [Egretta garzetta] gb|KFP34537.1| U6 snRNA-associated Sm-like LSm6 [Colius striatus] gb|KFP44282.1| U6 snRNA-associated Sm-like LSm6 [Chlamydotis macqueenii] gb|KFP47703.1| U6 snRNA-associated Sm-like LSm6 [Cathartes aura] gb|KFP76779.1| U6 snRNA-associated Sm-like LSm6 [Acanthisitta chloris] gb|KFP88005.1| U6 snRNA-associated Sm-like LSm6 [Apaloderma vittatum] gb|KFQ03439.1| U6 snRNA-associated Sm-like LSm6 [Haliaeetus albicilla] gb|KFQ16374.1| U6 snRNA-associated Sm-like LSm6 [Leptosomus discolor] gb|KFQ17922.1| U6 snRNA-associated Sm-like LSm6 [Merops nubicus] gb|KFQ26793.1| U6 snRNA-associated Sm-like LSm6 [Mesitornis unicolor] gb|KFQ43987.1| U6 snRNA-associated Sm-like LSm6 [Nestor notabilis] gb|KFQ60273.1| U6 snRNA-associated Sm-like LSm6 [Pelecanus crispus] gb|KFQ68333.1| U6 snRNA-associated Sm-like LSm6 [Phaethon lepturus] gb|KFQ83412.1| U6 snRNA-associated Sm-like LSm6 [Phoenicopterus ruber ruber] gb|KFR01077.1| U6 snRNA-associated Sm-like LSm6 [Nipponia nippon] gb|KFR17245.1| U6 snRNA-associated Sm-like LSm6 [Opisthocomus hoazin] gb|KFU86174.1| U6 snRNA-associated Sm-like LSm6 [Chaetura pelagica] gb|KFV11081.1| U6 snRNA-associated Sm-like LSm6 [Pterocles gutturalis] gb|KFV19613.1| U6 snRNA-associated Sm-like LSm6 [Tauraco erythrolophus] gb|KFV38738.1| U6 snRNA-associated Sm-like LSm6 [Tyto alba] gb|KFV39983.1| U6 snRNA-associated Sm-like LSm6 [Gavia stellata] gb|KFV64497.1| U6 snRNA-associated Sm-like LSm6 [Picoides pubescens] gb|KFV88723.1| U6 snRNA-associated Sm-like LSm6 [Struthio camelus australis] gb|KFV90647.1| U6 snRNA-associated Sm-like LSm6 [Eurypyga helias] gb|KFV95610.1| U6 snRNA-associated Sm-like LSm6 [Fulmarus glacialis] gb|KFW70400.1| U6 snRNA-associated Sm-like LSm6 [Pygoscelis adeliae] gb|KFW75162.1| U6 snRNA-associated Sm-like LSm6 [Manacus vitellinus] gb|KFW88678.1| U6 snRNA-associated Sm-like LSm6 [Phalacrocorax carbo] gb|KFZ52552.1| U6 snRNA-associated Sm-like LSm6 [Podiceps cristatus] gb|KGL80900.1| U6 snRNA-associated Sm-like LSm6 [Tinamus guttatus] gb|KGL97855.1| U6 snRNA-associated Sm-like LSm6 [Charadrius vociferus] gb|OBS73832.1| hypothetical protein A6R68_15629 [Neotoma lepida] gb|OCA48537.1| hypothetical protein XENTR_v90000936mg [Xenopus tropicalis] gb|OCA48538.1| hypothetical protein XENTR_v90000936mg [Xenopus tropicalis] gb|OCA48539.1| hypothetical protein XENTR_v90000936mg [Xenopus tropicalis] gb|OCT97030.1| hypothetical protein XELAEV_18009250mg [Xenopus laevis] gb|OCT99736.1| hypothetical protein XELAEV_18005517mg [Xenopus laevis] emb|SJX24228.1| unnamed protein product, partial [Human ORFeome Gateway entry vector] gb|OWK60393.1| U6 snRNA-associated Sm-like protein LSm6 [Lonchura striata domestica] gb|ATO96964.1| hypothetical protein, partial [synthetic construct] gb|PIO28649.1| U6 snRNA-associated Sm-like protein LSm6 [Rana catesbeiana] gb|PKK28950.1| LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated [Columba livia] gb|PNI63115.1| LSM6 isoform 1 [Pan troglodytes] gb|PNI63116.1| LSM6 isoform 2 [Pan troglodytes] gb|PNI63117.1| LSM6 isoform 4 [Pan troglodytes] gb|PNI63118.1| LSM6 isoform 5 [Pan troglodytes] gb|PNJ83677.1| LSM6 isoform 1 [Pongo abelii] gb|PNJ83678.1| LSM6 isoform 2 [Pongo abelii] gb|PNJ83679.1| LSM6 isoform 3 [Pongo abelii] gb|PNJ83680.1| LSM6 isoform 4 [Pongo abelii] Length = 80 Score = 133 bits (334), Expect = 7e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 64 FIRGNNVLYISTQKRR 79 >ref|XP_005864923.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Myotis brandtii] ref|XP_005864924.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Myotis brandtii] ref|XP_014393989.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Myotis brandtii] Length = 80 Score = 133 bits (334), Expect = 7e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 4 RKQTPSDFLTQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 64 FIRGNNVLYISTQKRR 79 >ref|XP_007897352.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Callorhinchus milii] ref|XP_020367431.1| U6 snRNA-associated Sm-like protein LSm6 [Rhincodon typus] ref|XP_020367432.1| U6 snRNA-associated Sm-like protein LSm6 [Rhincodon typus] ref|XP_020367433.1| U6 snRNA-associated Sm-like protein LSm6 [Rhincodon typus] gb|AFK10840.1| U6 snRNA-associated Sm-like protein LSm6 [Callorhinchus milii] Length = 80 Score = 133 bits (334), Expect = 7e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 64 FIRGNNVLYISTQKRR 79 >ref|XP_005995598.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Latimeria chalumnae] Length = 82 Score = 133 bits (334), Expect = 8e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 6 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 65 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 66 FIRGNNVLYISTQKRR 81 >ref|XP_010609228.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Fukomys damarensis] ref|XP_010609229.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Fukomys damarensis] Length = 84 Score = 133 bits (334), Expect = 8e-38 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 8 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 67 Query: 238 FIRGNNVLYISADKSR 191 FIRGNNVLYIS K R Sbjct: 68 FIRGNNVLYISTQKRR 83 >ref|XP_005883121.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Myotis brandtii] Length = 80 Score = 132 bits (333), Expect = 1e-37 Identities = 60/76 (78%), Positives = 71/76 (93%) Frame = -3 Query: 418 QEKTPTEFLNNVIGRPVLVKLNSGVDYRGILSCLDGYMNIALEQTEEWVNGQLKNKYGDA 239 +++TP++FL +IGRPV+VKLNSGVDYRG+L+CLDGYMNIALEQTEE+VNGQLKNKYGDA Sbjct: 4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDA 63 Query: 238 FIRGNNVLYISADKSR 191 F+RGNNVLYIS K R Sbjct: 64 FVRGNNVLYISTQKRR 79