BLASTX nr result
ID: Ophiopogon25_contig00041730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041730 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270526.1| GDSL esterase/lipase 5-like [Asparagus offic... 69 2e-10 ref|XP_010917471.1| PREDICTED: GDSL esterase/lipase 5-like [Elae... 56 7e-06 >ref|XP_020270526.1| GDSL esterase/lipase 5-like [Asparagus officinalis] Length = 384 Score = 69.3 bits (168), Expect = 2e-10 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -1 Query: 588 TDRIHEQFAKAIWSEPASPGANTLERLFFGAEEVM-IADAEDDRDELGKFTYIA 430 +++IHEQFAK IW EP+SP A TLE LFF E+++ I D E D +ELG FTYIA Sbjct: 331 SEKIHEQFAKEIWGEPSSPRAKTLEDLFFDREKIINIGDVESDENELGTFTYIA 384 >ref|XP_010917471.1| PREDICTED: GDSL esterase/lipase 5-like [Elaeis guineensis] Length = 394 Score = 56.2 bits (134), Expect = 7e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 588 TDRIHEQFAKAIWSEP-ASPGANTLERLFFGAEEVMIADAEDDRDELGKFTYIA 430 ++RIHEQ AK +WS+P +S G LE+LFFG E++ IAD D+ D LG F +A Sbjct: 341 SERIHEQVAKLLWSDPPSSVGPYNLEKLFFGEEKLRIADVVDEGDGLGDFGTLA 394