BLASTX nr result
ID: Ophiopogon25_contig00041723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041723 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK72626.1| hypothetical protein RhiirC2_742331 [Rhizophagus ... 51 5e-06 >gb|PKK72626.1| hypothetical protein RhiirC2_742331 [Rhizophagus irregularis] Length = 55 Score = 50.8 bits (120), Expect = 5e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = +2 Query: 101 KIATGEARPPLSNQNQSFNKSKIGILAEK--ITIYILR 208 KIATGEA PPLSNQNQSFNKSK + K TIYILR Sbjct: 17 KIATGEAHPPLSNQNQSFNKSKNRNIGPKNITTIYILR 54