BLASTX nr result
ID: Ophiopogon25_contig00041405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041405 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY23435.1| hypothetical protein RhiirB3_505801 [Rhizophagus ... 87 1e-18 gb|PKY43751.1| hypothetical protein RhiirA4_126893 [Rhizophagus ... 87 1e-18 gb|EXX57248.1| hypothetical protein RirG_208790 [Rhizophagus irr... 87 1e-18 >gb|PKY23435.1| hypothetical protein RhiirB3_505801 [Rhizophagus irregularis] Length = 208 Score = 87.0 bits (214), Expect = 1e-18 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 71 MPPKKSNRKWKVSRGGGHKFSNPRQLAGTGNEEGMWGYR 187 MPPKK+NRKWKVSRGGGHKF+NPRQL+GTGNEEGMWGYR Sbjct: 1 MPPKKNNRKWKVSRGGGHKFTNPRQLSGTGNEEGMWGYR 39 >gb|PKY43751.1| hypothetical protein RhiirA4_126893 [Rhizophagus irregularis] Length = 210 Score = 87.0 bits (214), Expect = 1e-18 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 71 MPPKKSNRKWKVSRGGGHKFSNPRQLAGTGNEEGMWGYR 187 MPPKK+NRKWKVSRGGGHKF+NPRQL+GTGNEEGMWGYR Sbjct: 1 MPPKKNNRKWKVSRGGGHKFTNPRQLSGTGNEEGMWGYR 39 >gb|EXX57248.1| hypothetical protein RirG_208790 [Rhizophagus irregularis DAOM 197198w] dbj|GBC47955.1| heat- and acid-stable phosphoprotein [Rhizophagus irregularis DAOM 181602] gb|PKC12956.1| hypothetical protein RhiirA5_83675 [Rhizophagus irregularis] gb|PKC71133.1| hypothetical protein RhiirA1_78554, partial [Rhizophagus irregularis] gb|PKK70572.1| hypothetical protein RhiirC2_779507 [Rhizophagus irregularis] gb|POG82444.1| casein kinase substrate phospho protein PP28-domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 210 Score = 87.0 bits (214), Expect = 1e-18 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 71 MPPKKSNRKWKVSRGGGHKFSNPRQLAGTGNEEGMWGYR 187 MPPKK+NRKWKVSRGGGHKF+NPRQL+GTGNEEGMWGYR Sbjct: 1 MPPKKNNRKWKVSRGGGHKFTNPRQLSGTGNEEGMWGYR 39