BLASTX nr result
ID: Ophiopogon25_contig00041336
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041336 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC45508.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 71 3e-13 dbj|GBC50727.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 71 3e-13 >dbj|GBC45508.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 123 Score = 70.9 bits (172), Expect = 3e-13 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +2 Query: 212 LIVDFDDVNNGSILEYTFGANYVNMITSRKSDQQPLLNLTI-VYKDRQG 355 LIVD +D NGSILEY FG NYVNMI SRKSDQ PLLNLT+ + KD QG Sbjct: 58 LIVDINDEYNGSILEYAFGVNYVNMIASRKSDQPPLLNLTLSICKDHQG 106 >dbj|GBC50727.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] dbj|GBC48210.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 123 Score = 70.9 bits (172), Expect = 3e-13 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +2 Query: 212 LIVDFDDVNNGSILEYTFGANYVNMITSRKSDQQPLLNLTI-VYKDRQG 355 LIVD +D NGSILEY FG NYVNMI SRKSDQ PLLNLT+ + KD QG Sbjct: 58 LIVDINDEYNGSILEYAFGVNYVNMIASRKSDQPPLLNLTLSICKDHQG 106