BLASTX nr result
ID: Ophiopogon25_contig00041318
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041318 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX56443.1| hypothetical protein RirG_216210 [Rhizophagus irr... 88 1e-19 gb|PKB98339.1| hypothetical protein RhiirA5_431522 [Rhizophagus ... 74 3e-14 >gb|EXX56443.1| hypothetical protein RirG_216210 [Rhizophagus irregularis DAOM 197198w] dbj|GBC43899.1| JEMT01027715.1_cds_EXX56443.1_23589 [Rhizophagus irregularis DAOM 181602] Length = 77 Score = 88.2 bits (217), Expect = 1e-19 Identities = 45/77 (58%), Positives = 55/77 (71%) Frame = -2 Query: 462 MKFPITKFAITIFVFLAYVAIITQADEFHDAHGYVDEFQAKHAKLMGNLKDIVAELDHRM 283 MKF TK AITIF+ LAY+AI++QA + GYV EFQAKH KLM +L+ V ELDHRM Sbjct: 1 MKFTTTKVAITIFMLLAYIAIVSQAIGIKNGGGYVQEFQAKHKKLMHDLRKTVDELDHRM 60 Query: 282 VVFKGKMKNYHEHKARI 232 VFK +M+ YHE A + Sbjct: 61 EVFKKRMEFYHEVGATV 77 >gb|PKB98339.1| hypothetical protein RhiirA5_431522 [Rhizophagus irregularis] gb|PKC65214.1| hypothetical protein RhiirA1_461342 [Rhizophagus irregularis] Length = 70 Score = 73.9 bits (180), Expect = 3e-14 Identities = 37/60 (61%), Positives = 44/60 (73%) Frame = -2 Query: 462 MKFPITKFAITIFVFLAYVAIITQADEFHDAHGYVDEFQAKHAKLMGNLKDIVAELDHRM 283 MKF TK AITIF+ LAY+AI++QA + GYV EFQAKH KLM +L+ V ELDHRM Sbjct: 1 MKFTTTKVAITIFMLLAYIAIVSQAIGIKNGGGYVQEFQAKHKKLMHDLRKTVDELDHRM 60