BLASTX nr result
ID: Ophiopogon25_contig00041128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041128 (811 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagu... 99 2e-22 gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagu... 99 2e-22 gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagu... 99 2e-22 dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus ... 99 1e-20 gb|ODM14678.1| hypothetical protein SI65_09867 [Aspergillus cris... 66 4e-10 gb|OAQ29312.1| hypothetical protein K457DRAFT_138085 [Mortierell... 66 6e-10 ref|XP_015410878.1| glycine-rich RNA-binding protein [Aspergillu... 65 1e-09 gb|OSS49532.1| hypothetical protein B5807_06016 [Epicoccum nigrum] 65 3e-09 gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Au... 63 3e-09 ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel... 63 4e-09 gb|KEQ82274.1| RNA-binding domain-containing protein, partial [A... 62 5e-09 gb|OJJ64165.1| hypothetical protein ASPSYDRAFT_96512, partial [A... 62 7e-09 gb|PIG84749.1| glycine-rich RNA-binding protein, partial [Asperg... 64 8e-09 gb|PNS18018.1| hypothetical protein CAC42_3977 [Elsinoe sp. CQ-2... 64 8e-09 gb|OJJ60762.1| hypothetical protein ASPSYDRAFT_29285 [Aspergillu... 62 1e-08 ref|XP_018297749.1| hypothetical protein PHYBLDRAFT_130118 [Phyc... 64 1e-08 gb|KZM25589.1| nucleic acid binding [Ascochyta rabiei] 64 1e-08 gb|KKY26122.1| putative rna recognition domain-containing protei... 63 1e-08 gb|OMP87351.1| Cold-inducible RNA-binding protein, partial [Dipl... 63 1e-08 gb|OHE77571.1| hypothetical protein A3G75_14995 [Verrucomicrobia... 62 2e-08 >gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 128 Score = 99.4 bits (246), Expect = 2e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 89 >gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 133 Score = 99.4 bits (246), Expect = 2e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 89 >gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKC70041.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKK73911.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|POG68613.1| hypothetical protein GLOIN_2v1635358 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 134 Score = 99.4 bits (246), Expect = 2e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS Sbjct: 41 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 89 >dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus irregularis DAOM 181602] Length = 319 Score = 99.4 bits (246), Expect = 1e-20 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS Sbjct: 226 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 274 >gb|ODM14678.1| hypothetical protein SI65_09867 [Aspergillus cristatus] Length = 114 Score = 66.2 bits (160), Expect = 4e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPR 524 GRSRGFGFV FAS +EA+IA QNLN+ EFDGR I+VD+AA+R APR Sbjct: 40 GRSRGFGFVRFASEQEADIAQQNLNNQEFDGRIIRVDKAADR---APR 84 >gb|OAQ29312.1| hypothetical protein K457DRAFT_138085 [Mortierella elongata AG-77] Length = 132 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 GRSRGFGFVTFA + A+ AIQ ND EF+GR IKVDRA+ERS+ Sbjct: 43 GRSRGFGFVTFADKDGADAAIQQFNDQEFEGRQIKVDRASERSN 86 >ref|XP_015410878.1| glycine-rich RNA-binding protein [Aspergillus nomius NRRL 13137] gb|KNG89955.1| glycine-rich RNA-binding protein [Aspergillus nomius NRRL 13137] Length = 122 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -1 Query: 664 RSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 RSRGFGFV F++ +EAE A+Q LN+ EFDGRNI+VD+A+ER S Sbjct: 41 RSRGFGFVRFSTEDEAEAAVQGLNNTEFDGRNIRVDKASERPS 83 >gb|OSS49532.1| hypothetical protein B5807_06016 [Epicoccum nigrum] Length = 158 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERS 539 GRSRGFGFV FAS+ EA+ A+QN+N+ EFDGR I+VD+A+ER+ Sbjct: 40 GRSRGFGFVRFASDAEADTAMQNMNNIEFDGRTIRVDKASERA 82 >gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Aureobasidium melanogenum CBS 110374] Length = 79 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 GRSRGFGFV F++ EEA+ AI+ +N+ EFDGR I+VD+A+ER S Sbjct: 33 GRSRGFGFVRFSNEEEADAAIKAMNEIEFDGRTIRVDKASERGS 76 >ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel28] emb|CAZ84464.1| unnamed protein product [Tuber melanosporum] Length = 91 Score = 62.8 bits (151), Expect = 4e-09 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAER 542 GRSRGFGFV ++S+EEA A+ N+ND EFDGR I+VD+A++R Sbjct: 40 GRSRGFGFVRYSSDEEATAAMDNMNDVEFDGRRIRVDKASDR 81 >gb|KEQ82274.1| RNA-binding domain-containing protein, partial [Aureobasidium pullulans EXF-150] Length = 89 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 GRSRGFGFV F++ +EA+ AI+ +N+ EFDGR I+VD+A+ER S Sbjct: 32 GRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASERGS 75 >gb|OJJ64165.1| hypothetical protein ASPSYDRAFT_96512, partial [Aspergillus sydowii CBS 593.65] Length = 91 Score = 62.0 bits (149), Expect = 7e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 673 LKGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSP 533 + GRSRGFGFV FA +AE A++ L++ EFDGR I+VD A+ERS+P Sbjct: 31 ITGRSRGFGFVRFALERDAESAVRGLDNQEFDGRTIRVDHASERSNP 77 >gb|PIG84749.1| glycine-rich RNA-binding protein, partial [Aspergillus arachidicola] Length = 182 Score = 64.3 bits (155), Expect = 8e-09 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 GRSRGFGFV F+S +A+ A++N+N+ EFDGR+I+VD+A+ER P PR+ Sbjct: 92 GRSRGFGFVRFSSEADADKAVENMNNVEFDGRSIRVDKASERERP-PRN 139 >gb|PNS18018.1| hypothetical protein CAC42_3977 [Elsinoe sp. CQ-2017a] Length = 167 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSP 533 GRSRGFGFV FAS +A+ AI+ +N+ EFDGR I+VD+A+ERS P Sbjct: 40 GRSRGFGFVRFASETDADKAIEAMNNVEFDGRQIRVDKASERSGP 84 >gb|OJJ60762.1| hypothetical protein ASPSYDRAFT_29285 [Aspergillus sydowii CBS 593.65] Length = 120 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -1 Query: 664 RSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSP 533 RSRGFGFV F++ EA+ A+ N+N+ EFDGR I+VD+A+ERS+P Sbjct: 41 RSRGFGFVRFSTEAEAQTAMDNMNNQEFDGRTIRVDKASERSNP 84 >ref|XP_018297749.1| hypothetical protein PHYBLDRAFT_130118 [Phycomyces blakesleeanus NRRL 1555(-)] gb|OAD79709.1| hypothetical protein PHYBLDRAFT_130118 [Phycomyces blakesleeanus NRRL 1555(-)] Length = 168 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPR 524 GRSRGFGFVTF+ N EA+ A+ LN+ + DGR IKVDRAAER R Sbjct: 41 GRSRGFGFVTFSDNGEAQAAVDALNEQDLDGRRIKVDRAAERGDRTER 88 >gb|KZM25589.1| nucleic acid binding [Ascochyta rabiei] Length = 186 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERS 539 GRSRGFGFV FAS+ EA+ A+QN+N+ EFDGR ++VD+A++R+ Sbjct: 40 GRSRGFGFVRFASDAEADTAMQNMNNVEFDGRTVRVDKASDRA 82 >gb|KKY26122.1| putative rna recognition domain-containing protein [Diplodia seriata] Length = 154 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 GRSRGFGFV F + +AE AIQ++N+ EFDGR I+VD+A++RSS Sbjct: 40 GRSRGFGFVRFTQDADAEAAIQSMNNVEFDGRTIRVDKASDRSS 83 >gb|OMP87351.1| Cold-inducible RNA-binding protein, partial [Diplodia seriata] Length = 157 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 667 GRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSS 536 GRSRGFGFV F + +AE AIQ++N+ EFDGR I+VD+A++RSS Sbjct: 33 GRSRGFGFVRFTQDADAEAAIQSMNNVEFDGRTIRVDKASDRSS 76 >gb|OHE77571.1| hypothetical protein A3G75_14995 [Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8] Length = 109 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = -1 Query: 691 FVNSCNLKGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAERSSPAPRS 521 FV S GR+RGF FVTFA+ E+++AI+ +N EF+GR + V A + SP+PRS Sbjct: 33 FVASDQFTGRARGFAFVTFAAEAESKVAIEKMNGVEFEGRPLTVSEARPKESPSPRS 89