BLASTX nr result
ID: Ophiopogon25_contig00041074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00041074 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16017.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 53 5e-06 >dbj|GBC16017.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 95 Score = 52.8 bits (125), Expect = 5e-06 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -1 Query: 147 DMEFRNEPVPDVWMMEFWNSKR--TGSRTFGLNEPVPDAWMMKIETNRF 7 D E RNEPVPDV M E S R G+R NEPVPD W+M+I+TNRF Sbjct: 24 DNELRNEPVPDVRMNETTGSGRLDNGNR----NEPVPDVWIMEIKTNRF 68