BLASTX nr result
ID: Ophiopogon25_contig00040789
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00040789 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS82603.1| putative glycerol 3-phosphate permease [Zea mays] 68 2e-10 gb|OTF90552.1| putative reverse transcriptase domain, Reverse tr... 67 5e-10 gb|OTG01412.1| putative RNA-directed DNA polymerase, eukaryota [... 66 1e-09 gb|EEE63169.1| hypothetical protein OsJ_17978 [Oryza sativa Japo... 65 1e-09 ref|XP_022019476.1| uncharacterized protein LOC110919519 [Helian... 63 2e-09 ref|XP_022032645.1| uncharacterized protein LOC110933746 [Helian... 65 2e-09 ref|XP_021974964.1| uncharacterized protein LOC110870073 [Helian... 65 2e-09 ref|XP_023731127.1| uncharacterized protein LOC111878881 [Lactuc... 65 2e-09 emb|CAN69053.1| hypothetical protein VITISV_022963 [Vitis vinifera] 55 3e-09 emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] 52 4e-09 ref|XP_023740961.1| uncharacterized protein LOC111889057 [Lactuc... 62 4e-09 gb|OTG34974.1| putative reverse transcriptase domain, Zinc finge... 64 4e-09 ref|XP_022013757.1| uncharacterized protein LOC110913218 [Helian... 64 5e-09 ref|XP_023732801.1| uncharacterized protein LOC111880611 [Lactuc... 61 5e-09 gb|ABA91325.1| retrotransposon protein, putative, unclassified [... 64 6e-09 dbj|BAC15618.2| unnamed protein product [Oryza sativa Japonica G... 64 6e-09 ref|XP_019429814.1| PREDICTED: uncharacterized protein LOC109337... 54 6e-09 gb|ABA95227.1| retrotransposon protein, putative, unclassified [... 64 6e-09 ref|XP_015935098.1| uncharacterized protein LOC107461148 [Arachi... 60 7e-09 gb|EEE67600.1| hypothetical protein OsJ_25151 [Oryza sativa Japo... 63 7e-09 >gb|AAS82603.1| putative glycerol 3-phosphate permease [Zea mays] Length = 1279 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/60 (53%), Positives = 39/60 (65%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERSCR 187 KW+ WI M L + VL+NG PGK CRR RQGD LSPLLFVL D L+ V ++C+ Sbjct: 219 KWIHWISMILGSGSSEVLLNGVPGKRFHCRRGVRQGDPLSPLLFVLAADLLQTIVNKACK 278 >gb|OTF90552.1| putative reverse transcriptase domain, Reverse transcriptase zinc-binding domain protein [Helianthus annuus] Length = 661 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERSC 184 KW WIK LS+A+ +VL+NG P E C + RQGD +SP LFV+V++ L C + R+C Sbjct: 126 KWCSWIKGILSSARASVLVNGAPTFEFKCNKGMRQGDPISPFLFVIVMESLSCMISRAC 184 >gb|OTG01412.1| putative RNA-directed DNA polymerase, eukaryota [Helianthus annuus] Length = 1760 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/59 (47%), Positives = 41/59 (69%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERSC 184 +W WIK LS+A+ +VL+NG P E C + RQGD +SP LFV+V++ L C +E++C Sbjct: 1154 RWCSWIKGILSSARASVLVNGSPTFEFKCHKGMRQGDPISPFLFVIVMEALSCMLEKAC 1212 >gb|EEE63169.1| hypothetical protein OsJ_17978 [Oryza sativa Japonica Group] Length = 565 Score = 65.5 bits (158), Expect = 1e-09 Identities = 36/77 (46%), Positives = 49/77 (63%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P W+ WIK LS++K VL+NG PG+ I C++ RQGD LSP LFVLV D L+ +ER+ Sbjct: 66 PENWISWIKGLLSSSKSAVLLNGVPGRWIRCKKGLRQGDPLSPYLFVLVADVLQRLLERN 125 Query: 182 CRE*SNQRLGSFQDYIC 232 + R +QD +C Sbjct: 126 ----TEIRHAIYQDRLC 138 >ref|XP_022019476.1| uncharacterized protein LOC110919519 [Helianthus annuus] Length = 183 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/61 (44%), Positives = 41/61 (67%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P KW RW+ +++A+ +VL+NG P +E C R RQGD LSP LFVL ++ L ++++ Sbjct: 29 PVKWRRWVMSIVTSARASVLVNGSPTQEFTCSRGLRQGDPLSPFLFVLAMEALTGVMKKA 88 Query: 182 C 184 C Sbjct: 89 C 89 >ref|XP_022032645.1| uncharacterized protein LOC110933746 [Helianthus annuus] Length = 473 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KW WIK LS+A+ +VL+NG P E C + RQGDL+SP LFV+V++ L C + R+ Sbjct: 6 KWCTWIKGILSSARASVLVNGAPTFEFKCNKGMRQGDLISPFLFVIVMEALSCMIVRA 63 >ref|XP_021974964.1| uncharacterized protein LOC110870073 [Helianthus annuus] Length = 384 Score = 64.7 bits (156), Expect = 2e-09 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P +W W+K L +A+ VL+NG P E C + RQGD LSP LF++V++ L C + ++ Sbjct: 297 PSRWCMWVKGILQSARSAVLVNGSPTFEFQCHKGPRQGDPLSPFLFLIVMEALACMISKA 356 Query: 182 CR 187 CR Sbjct: 357 CR 358 >ref|XP_023731127.1| uncharacterized protein LOC111878881 [Lactuca sativa] Length = 999 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KW RWIK LSTA+ +VLING P E R RQGD+LSP LF+L ++GL + R+ Sbjct: 473 KWCRWIKELLSTARASVLINGSPTDEFQIHRGLRQGDMLSPFLFILAMEGLHFALTRA 530 >emb|CAN69053.1| hypothetical protein VITISV_022963 [Vitis vinifera] Length = 2021 Score = 55.1 bits (131), Expect(3) = 3e-09 Identities = 26/58 (44%), Positives = 36/58 (62%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KW +WI +ST ++ VL+NG P R RQGD LSP LFVL+++GL + R+ Sbjct: 1411 KWRKWIFYCISTVRMAVLVNGTPTDFFSTFRGLRQGDPLSPYLFVLIMEGLSSLISRA 1468 Score = 30.4 bits (67), Expect(3) = 3e-09 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 331 EIVVIKWILGTFEM*SRLKINLNKSAII 414 +++ KW++ FE+ S LKINL KS II Sbjct: 1508 QLIFWKWVVICFEVVSGLKINLQKSEII 1535 Score = 22.7 bits (47), Expect(3) = 3e-09 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 231 VNSLHYEDNTLLFGEEDIRQVV 296 V+ L + D+TLLF E+D Q++ Sbjct: 1489 VSHLLFADDTLLFCEDDRDQLI 1510 >emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] Length = 843 Score = 52.4 bits (124), Expect(3) = 4e-09 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KW WI +ST ++ VL+NG P K R RQGD LSP LFVL+++ + ++ Sbjct: 239 KWRSWILFCISTVRMAVLVNGTPTKFFSTYRGLRQGDPLSPYLFVLIMEAFSSLISKA 296 Score = 32.3 bits (72), Expect(3) = 4e-09 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +1 Query: 331 EIVVIKWILGTFEM*SRLKINLNKSAII 414 ++V KW++ FEM S LKINL KS II Sbjct: 336 QLVFWKWVVICFEMVSGLKINLKKSEII 363 Score = 23.1 bits (48), Expect(3) = 4e-09 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 225 TYVNSLHYEDNTLLFGEEDIRQVV 296 T V+ L + D+TLLF E++ Q+V Sbjct: 315 TSVSHLLFADDTLLFCEDNRNQLV 338 >ref|XP_023740961.1| uncharacterized protein LOC111889057 [Lactuca sativa] Length = 158 Score = 61.6 bits (148), Expect = 4e-09 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KW RWIK LST + +VLING P E R RQGD LSP LF+L ++GL + R+ Sbjct: 6 KWCRWIKELLSTTRASVLINGSPTDEFQIHRGLRQGDPLSPFLFILAMEGLHIALTRA 63 >gb|OTG34974.1| putative reverse transcriptase domain, Zinc finger, CCHC-type, Isoprenoid synthase domain protein [Helianthus annuus] Length = 845 Score = 63.9 bits (154), Expect = 4e-09 Identities = 28/63 (44%), Positives = 42/63 (66%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P KW RW+K +STA+ +VL+NG P E C R RQGD +SP LF++ ++GL +R+ Sbjct: 505 PDKWKRWMKALMSTARSSVLVNGSPTFEFLCTRGIRQGDPISPFLFIIGMEGLTVMFKRA 564 Query: 182 CRE 190 ++ Sbjct: 565 VQQ 567 >ref|XP_022013757.1| uncharacterized protein LOC110913218 [Helianthus annuus] Length = 1133 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/59 (45%), Positives = 39/59 (66%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERSC 184 KW W+K LS+A+ +VL+NG P E C + RQGD LSP LFV+ ++ L C + ++C Sbjct: 393 KWRSWVKGVLSSARASVLVNGAPTFEFKCSKGMRQGDPLSPFLFVIAMEALSCMIRKAC 451 >ref|XP_023732801.1| uncharacterized protein LOC111880611 [Lactuca sativa] Length = 136 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/58 (44%), Positives = 40/58 (68%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 KWMRWI+ +L + + ++LING P KE +R RQGD L+ LF++ ++GLK + +S Sbjct: 33 KWMRWIRGYLGSIRASILINGAPMKEFNIKRGLRQGDPLAHFLFIIAIEGLKVNLHKS 90 >gb|ABA91325.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 658 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P W+ WIK L T+K VL+NG PGK I C++ RQGD LSP LF+LV D L+ +E++ Sbjct: 120 PNNWISWIKSLLQTSKSAVLLNGIPGKWINCKKGLRQGDPLSPYLFILVADVLQRLLEKN 179 >dbj|BAC15618.2| unnamed protein product [Oryza sativa Japonica Group] Length = 1197 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P W+ WIK L T+K VL+NG PGK I C++ RQGD LSP LF+LV D L+ +E++ Sbjct: 609 PNNWISWIKSLLQTSKSAVLLNGIPGKWINCKKGLRQGDPLSPYLFILVADVLQRLLEKN 668 >ref|XP_019429814.1| PREDICTED: uncharacterized protein LOC109337317, partial [Lupinus angustifolius] Length = 586 Score = 54.3 bits (129), Expect(3) = 6e-09 Identities = 23/51 (45%), Positives = 32/51 (62%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGL 160 KW WIK L + ++L+NG P E R RQGDL++P LF++V +GL Sbjct: 354 KWRNWIKSCLQSNSFSILVNGSPTSEFRMARGLRQGDLIAPFLFLIVAEGL 404 Score = 28.9 bits (63), Expect(3) = 6e-09 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +1 Query: 334 IVVIKWILGTFEM*SRLKINLNKSAII 414 I+V+K IL FE+ S LKIN +KS+ I Sbjct: 449 IMVLKSILKCFELVSGLKINFHKSSFI 475 Score = 23.9 bits (50), Expect(3) = 6e-09 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 204 GLEVSRTTYVNS-LHYEDNTLLFGEEDIRQVV 296 G V R V S L Y D+TLL GE + ++ Sbjct: 419 GYSVGRDKIVISHLQYADDTLLIGENSVDNIM 450 >gb|ABA95227.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 2776 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P W+ WIK L T+K VL+NG PGK I C++ RQGD LSP LF+LV D L+ +E++ Sbjct: 2111 PNNWISWIKSLLQTSKSAVLLNGIPGKWINCKKGLRQGDPLSPYLFILVADVLQRLLEKN 2170 >ref|XP_015935098.1| uncharacterized protein LOC107461148 [Arachis duranensis] Length = 134 Score = 60.5 bits (145), Expect = 7e-09 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +2 Query: 8 KWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERSCR 187 KW W++ ++TA ++VLING P K R RQGD LSP LFVLVVD L +E R Sbjct: 6 KWRAWVRECVTTASMSVLINGSPSKSFKMERGLRQGDPLSPFLFVLVVDVLHRMIEEVVR 65 >gb|EEE67600.1| hypothetical protein OsJ_25151 [Oryza sativa Japonica Group] Length = 408 Score = 63.2 bits (152), Expect = 7e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +2 Query: 2 PCKWMRWIKMWLSTAKLNVLINGEPGKEICCRRA*RQGDLLSPLLFVLVVDGLKCRVERS 181 P W+ WIK L T+K VL++G PGK I C++ RQGD LSP LF+LV D L+ +ER+ Sbjct: 62 PDNWISWIKNLLQTSKSAVLLHGIPGKWITCKKGLRQGDPLSPYLFILVADVLQRLLERN 121