BLASTX nr result
ID: Ophiopogon25_contig00040761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00040761 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243112.1| serine/threonine-protein phosphatase 1 regul... 60 2e-08 gb|ABB55280.1| hypothetical protein 10.t00020 [Asparagus officin... 57 3e-07 >ref|XP_020243112.1| serine/threonine-protein phosphatase 1 regulatory subunit 10-like [Asparagus officinalis] Length = 160 Score = 60.5 bits (145), Expect = 2e-08 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 435 MAGNGNGDLSLQGLYNRINSIDERLGTMKTFLQSLQQAIEGLSLQFN-DNNFNGSFH 268 MAG+G +LSLQ L RI+S+D R GT++ LQ+LQQAIEGL+L N +NNF H Sbjct: 1 MAGDGEKELSLQDLSTRIDSMDGRFGTLEASLQNLQQAIEGLTLHLNIENNFVDCLH 57 >gb|ABB55280.1| hypothetical protein 10.t00020 [Asparagus officinalis] Length = 142 Score = 57.0 bits (136), Expect = 3e-07 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 435 MAGNGNGDLSLQGLYNRINSIDERLGTMKTFLQSLQQAIEGLSLQFND-NNFNGSFHQGR 259 MAG+G +LS Q L R++S+D R GT++ LQ+LQQA EGL+L N+ NNF H G Sbjct: 1 MAGDGEKELSEQDLSVRMSSMDGRFGTLEASLQNLQQAFEGLTLHLNNGNNFTDGLHLGG 60 Query: 258 PSV 250 V Sbjct: 61 SGV 63