BLASTX nr result
ID: Ophiopogon25_contig00040679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00040679 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bact... 123 1e-33 gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Atta... 122 4e-33 gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roys... 118 9e-32 gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] 114 7e-30 ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) ... 105 5e-26 ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) ... 105 5e-26 ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Z... 100 2e-24 emb|CDY45543.1| BnaCnng13020D [Brassica napus] >gi|674913490|emb... 101 2e-24 ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) ... 99 3e-24 gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Br... 98 1e-23 ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayenne... 98 1e-23 ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula... 100 2e-23 gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Br... 97 3e-23 gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] >gi|209... 97 4e-23 gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Br... 95 8e-23 ref|YP_009469484.1| Ycf15 (chloroplast) [Anemoclema glaucifolium... 96 1e-22 ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) ... 93 4e-22 gb|AVM10538.1| hypothetical chloroplast RF15 (chloroplast) [Crem... 92 2e-21 ref|YP_009048244.1| Ycf15 (chloroplast) [Calanthe triplicata] >g... 91 3e-21 ref|YP_009443190.1| hypothetical chloroplast RF15 (chloroplast) ... 90 8e-21 >gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bactris major] gb|AKF01189.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] gb|AKF01208.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] Length = 107 Score = 123 bits (309), Expect = 1e-33 Identities = 61/64 (95%), Positives = 61/64 (95%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PIQIFTTKRYWILFRIGPERRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 227 SLKR 238 SLKR Sbjct: 80 SLKR 83 >gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Attalea speciosa] gb|AOX12842.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] gb|AOX12863.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] Length = 107 Score = 122 bits (306), Expect = 4e-33 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PIQIFTTKRYWILFRIGPERRR+AGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRRAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 227 SLKR 238 SLKR Sbjct: 80 SLKR 83 >gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roystonea regia] Length = 85 Score = 118 bits (295), Expect = 9e-32 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +2 Query: 56 IQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLK 235 +QIFTTKRYWILFRIGPERRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQSLK Sbjct: 1 MQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQSLK 60 Query: 236 R 238 R Sbjct: 61 R 61 >gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] Length = 126 Score = 114 bits (286), Expect = 7e-30 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = +2 Query: 62 IFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRT 241 IFTTKRYWILFRIGPERRR+AGMPT VCLFSNSPDPIVPI GTSSAKVTE VSRQSLKRT Sbjct: 20 IFTTKRYWILFRIGPERRREAGMPTDVCLFSNSPDPIVPIFGTSSAKVTEWVSRQSLKRT 79 Score = 61.6 bits (148), Expect = 3e-09 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = +1 Query: 373 KRTPHSLDREDRQDFVICCRTYSNSS--DSDRGD 468 KRTPHSLDREDRQDFVI CRTYSNS+ DSDRGD Sbjct: 77 KRTPHSLDREDRQDFVIRCRTYSNSNSPDSDRGD 110 >ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] gb|AGP51110.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] Length = 132 Score = 105 bits (261), Expect = 5e-26 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 227 S 229 S Sbjct: 106 S 106 >ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] ref|YP_008474343.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] ref|YP_008474434.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] ref|YP_008963948.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] ref|YP_008963869.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AFH89553.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] gb|AFN42416.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] gb|AGP50797.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. vulgare] gb|AGP50874.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP50954.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP51034.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] gb|AGP51189.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum subsp. aegilopoides] gb|AGP51326.1| hypothetical chloroplast RF2 (chloroplast) [Triticum aestivum] gb|AGY92899.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AGY92978.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] Length = 132 Score = 105 bits (261), Expect = 5e-26 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 227 S 229 S Sbjct: 106 S 106 >ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Zea mays] ref|NP_043104.1| hypothetical protein ZemaCp103 (chloroplast) [Zea mays] ref|YP_024326.1| hypothetical protein PS017 [Saccharum hybrid cultivar SP-80-3280] ref|YP_024354.1| hypothetical protein PS069 [Saccharum hybrid cultivar SP-80-3280] ref|YP_054680.1| hypothetical protein SaofCp074 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_054713.1| hypothetical protein SaofCp107 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_009192458.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192495.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192580.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] ref|YP_009192617.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] ref|YP_009240086.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009240105.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009245464.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009245481.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009271710.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009271729.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009332191.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009332208.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009389617.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009389648.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009421788.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421819.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421894.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009421925.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009422000.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422031.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422106.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] ref|YP_009422137.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] sp|P46666.1|YCF15_MAIZE PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 99 sp|Q6ENR3.1|YCF15_SACOF PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF99 sp|Q6L3C4.1|YCF15_SACHY RecName: Full=Putative uncharacterized protein ycf15 emb|CAA60336.1| hypothetical protein (chloroplast) [Zea mays] emb|CAA60365.1| hypothetical protein (chloroplast) [Zea mays] gb|AAT44641.1| hypothetical protein PS017 (chloroplast) [Saccharum hybrid cultivar SP80-3280] gb|AAT44668.1| unknown (chloroplast) [Saccharum hybrid cultivar SP80-3280] dbj|BAD27343.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] dbj|BAD27377.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gb|AHV90369.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|AHV90388.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|ALP29685.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29722.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29807.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] gb|ALP29844.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] gb|AMN87236.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMN87255.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMR98047.1| ycf15 (chloroplast) [Chrysopogon serrulatus] gb|AMR98064.1| ycf15 (chloroplast) [Chrysopogon serrulatus] dbj|BAV38295.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38315.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38382.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] dbj|BAV38400.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] gb|AOD27724.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|AOD27744.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|APH82158.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|APH82175.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|ARS74330.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74349.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74416.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74435.1| ycf15 (chloroplast) [Chrysopogon zizanioides] emb|CRK62358.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62390.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62586.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62618.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62477.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRK62509.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRY90712.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY90744.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY89078.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89110.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89187.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89219.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89296.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89328.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89405.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89437.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89514.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89546.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89623.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89655.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89732.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89764.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89841.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89873.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89950.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY89982.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY90059.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90091.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90168.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90200.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90277.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90309.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90385.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90417.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90494.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90526.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90603.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] emb|CRY90635.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] gb|ASV52297.1| hypothetical protein (chloroplast) [Saccharum officinarum] gb|ASV52330.1| hypothetical protein (chloroplast) [Saccharum officinarum] emb|CUS18930.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS18963.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS19196.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19229.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19089.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CUS19122.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] Length = 99 Score = 100 bits (248), Expect = 2e-24 Identities = 49/61 (80%), Positives = 52/61 (85%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKR WILFRIGPERRR+A MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 227 S 229 S Sbjct: 77 S 77 >emb|CDY45543.1| BnaCnng13020D [Brassica napus] emb|CDY19675.1| BnaC09g29310D [Brassica napus] Length = 148 Score = 101 bits (251), Expect = 2e-24 Identities = 65/134 (48%), Positives = 71/134 (52%), Gaps = 2/134 (1%) Frame = -1 Query: 442 WNRFGSRSRNLGDLLYLMNEE--SVWKSSAPRHPPSIYDSTGIAQG*IDRNL**NTHQYP 269 WN+FGS SRNLGDLLYLMN E S KSSA R P++YDSTGI QG Sbjct: 40 WNKFGSGSRNLGDLLYLMNGEGESALKSSALR--PAVYDSTGITQG-------------- 83 Query: 268 *PSG*STLHSPF*GLATYSFSDFGTGRSQNGYYRVG*IRE*TDACWHSSLPSPFRAYPKE 89 DFGTG + G + DA HSSLPSPFR YPK+ Sbjct: 84 ---------------------DFGTGWTLPKLVLSGRVNSIIDAWRHSSLPSPFRTYPKQ 122 Query: 88 NPVPLGREYLNRMN 47 NPV LGREYLNR N Sbjct: 123 NPVLLGREYLNRAN 136 >ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] ref|YP_009269905.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72796.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72814.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] Length = 80 Score = 99.0 bits (245), Expect = 3e-24 Identities = 51/60 (85%), Positives = 53/60 (88%) Frame = +2 Query: 65 FTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 244 ++ R ILFRIGPERRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 21 YSRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 80 >gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Brachypodium distachyon] Length = 96 Score = 97.8 bits (242), Expect = 1e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKRYWILFRIGPERRRKA MPT + LFSNSP+PIVP+ GTS AKVTE VS Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLYLFSNSPEPIVPVFGTSGAKVTEWVSHQ 73 Query: 227 S 229 S Sbjct: 74 S 74 >ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245312.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245380.1| ycf15 (chloroplast) [Eriochrysis laxa] ref|YP_009245397.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97708.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97725.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97793.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97810.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97878.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97895.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97963.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97980.1| ycf15 (chloroplast) [Eriochrysis laxa] Length = 99 Score = 97.8 bits (242), Expect = 1e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKR WILFRIGPERRR+A MP +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPMDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 227 S 229 S Sbjct: 77 S 77 >ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula] gb|KEH17701.1| ycf15 protein, putative [Medicago truncatula] Length = 194 Score = 100 bits (248), Expect = 2e-23 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE 211 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTE 100 >gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Brachypodium distachyon] Length = 96 Score = 97.1 bits (240), Expect = 3e-23 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKRYWILFRIGPERRRKA MPT + LFSNSP+PIVP+ GTSSA+VTE +S Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLSLFSNSPEPIVPVFGTSSAEVTESLSHQ 73 Query: 227 S 229 S Sbjct: 74 S 74 >gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] gb|ACI43256.1| unknown (chloroplast) [Coix lacryma-jobi] Length = 99 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PI IF TKR WILFRIGPERRR+A MPT +CLFSNSPD IVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDRIVPVFGTSSAKVTEWVSHQ 76 Query: 227 S 229 S Sbjct: 77 S 77 >gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Brachypodium distachyon] gb|PNT75429.1| hypothetical protein BRADI_1g32457v3, partial [Brachypodium distachyon] gb|PNT75857.1| hypothetical protein BRADI_1g05793v3, partial [Brachypodium distachyon] Length = 75 Score = 95.1 bits (235), Expect = 8e-23 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = +2 Query: 71 TKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQS 229 TKRYWILFRIGPERRRKA MPT +CLFSNSP+PIVP+ GTSSAKVTE VS QS Sbjct: 1 TKRYWILFRIGPERRRKAEMPTDLCLFSNSPEPIVPVFGTSSAKVTEWVSHQS 53 >ref|YP_009469484.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] ref|YP_009469501.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] gb|AVD96771.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] gb|AVD96772.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] Length = 112 Score = 95.9 bits (237), Expect = 1e-22 Identities = 54/90 (60%), Positives = 60/90 (66%), Gaps = 4/90 (4%) Frame = +1 Query: 211 MSKSPIPKTDYVMYFIRWVXXXXXXXXXXXXQSTPVRFLLN-HIYSGG-GAGRTISKRTP 384 M KSP+PKTDYVMYFI WV + ++ +Y+ G GAGRTISK TP Sbjct: 1 MGKSPLPKTDYVMYFICWVTVTGAGILPEVSIVSIYPCVIPVEVYTRGVGAGRTISKWTP 60 Query: 385 HSLDREDRQDFVICCRTYSNSS--DSDRGD 468 HSLDRE RQDFVICCRTYSNS DSDRGD Sbjct: 61 HSLDREGRQDFVICCRTYSNSKRPDSDRGD 90 >ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] ref|YP_009269707.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72602.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72617.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] Length = 61 Score = 92.8 bits (229), Expect = 4e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +2 Query: 95 RIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 244 RIGPERRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 12 RIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 61 >gb|AVM10538.1| hypothetical chloroplast RF15 (chloroplast) [Cremastra appendiculata] Length = 80 Score = 91.7 bits (226), Expect = 2e-21 Identities = 50/62 (80%), Positives = 52/62 (83%) Frame = +2 Query: 47 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 226 V PIQ + R ILFRIGPERRRKAGMPT VCLFSNSPDP+VPIL TSSAKVTE VSRQ Sbjct: 20 VRPIQ--SRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPMVPILRTSSAKVTEWVSRQ 77 Query: 227 SL 232 SL Sbjct: 78 SL 79 >ref|YP_009048244.1| Ycf15 (chloroplast) [Calanthe triplicata] ref|YP_009048261.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|AHF71882.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|AHF71883.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|ANZ02142.1| hypothetical chloroplast RF15 (chloroplast) [Dendrobium nobile] gb|ANZ02153.1| hypothetical chloroplast RF15 (chloroplast) [Dendrobium nobile] gb|AVM10456.1| Ycf15 (chloroplast) [Calanthe davidii] gb|AVM10479.1| Ycf15 (chloroplast) [Calanthe davidii] Length = 77 Score = 91.3 bits (225), Expect = 3e-21 Identities = 47/56 (83%), Positives = 49/56 (87%) Frame = +2 Query: 65 FTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSL 232 ++ R ILFRIGPERRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSL Sbjct: 21 YSRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSL 76 >ref|YP_009443190.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] ref|YP_009443208.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] gb|ATP74855.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] gb|ATP74856.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] Length = 77 Score = 90.1 bits (222), Expect = 8e-21 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +2 Query: 65 FTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSL 232 ++ R ILFRIGPERRR+AGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSL Sbjct: 21 YSRPRGTILFRIGPERRRRAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSL 76