BLASTX nr result
ID: Ophiopogon25_contig00040654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00040654 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265356.1| glutamate receptor 2.8-like [Asparagus offic... 64 1e-08 >ref|XP_020265356.1| glutamate receptor 2.8-like [Asparagus officinalis] Length = 357 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +3 Query: 123 FRRVGGLFLITGCVSSLALLHSLVIMIYKKWDDLKRVVSWSNLSERMVEWARYY 284 F+ GLFLITGCVSSLALL LV +Y++W LK S +LS ++ EWARYY Sbjct: 237 FQSFSGLFLITGCVSSLALLIFLVTFLYREWGGLKITASQISLSTKIKEWARYY 290