BLASTX nr result
ID: Ophiopogon25_contig00039169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00039169 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266023.1| pectin acetylesterase 5-like [Asparagus offi... 62 5e-08 gb|ONK77081.1| uncharacterized protein A4U43_C02F2910 [Asparagus... 61 1e-07 gb|PHT36337.1| Pectin acetylesterase 4 [Capsicum baccatum] 61 1e-07 gb|PHU05090.1| Pectin acetylesterase 5 [Capsicum chinense] 59 3e-07 ref|XP_015089241.1| PREDICTED: pectin acetylesterase 5-like [Sol... 59 4e-07 ref|XP_004249600.1| PREDICTED: pectin acetylesterase 5 [Solanum ... 59 4e-07 gb|PHT70561.1| Pectin acetylesterase 5 [Capsicum annuum] 59 4e-07 ref|XP_016580250.1| PREDICTED: pectin acetylesterase 5-like [Cap... 59 4e-07 ref|XP_021750735.1| pectin acetylesterase 5-like isoform X1 [Che... 57 3e-06 gb|PIA60244.1| hypothetical protein AQUCO_00300035v1 [Aquilegia ... 56 3e-06 gb|PIA60245.1| hypothetical protein AQUCO_00300035v1 [Aquilegia ... 56 3e-06 gb|PIA60243.1| hypothetical protein AQUCO_00300035v1 [Aquilegia ... 56 3e-06 gb|KMZ58047.1| hypothetical protein ZOSMA_7G00760 [Zostera marina] 52 3e-06 gb|KRH33670.1| hypothetical protein GLYMA_10G139200 [Glycine max] 57 3e-06 ref|XP_009399871.1| PREDICTED: pectin acetylesterase 5 [Musa acu... 57 4e-06 gb|PIA60246.1| hypothetical protein AQUCO_00300035v1 [Aquilegia ... 56 4e-06 gb|ERN07834.1| hypothetical protein AMTR_s00012p00191170 [Ambore... 56 5e-06 ref|XP_020523992.1| pectin acetylesterase 5 isoform X2 [Amborell... 56 5e-06 ref|XP_011624087.1| pectin acetylesterase 5 isoform X3 [Amborell... 56 5e-06 ref|XP_015165082.1| PREDICTED: pectin acetylesterase 5-like [Sol... 56 5e-06 >ref|XP_020266023.1| pectin acetylesterase 5-like [Asparagus officinalis] gb|ONK67761.1| uncharacterized protein A4U43_C05F3500 [Asparagus officinalis] Length = 425 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGSRPGYHLQRGFGSG+D WVLH+E Sbjct: 73 VCLDGSRPGYHLQRGFGSGSDSWVLHLE 100 >gb|ONK77081.1| uncharacterized protein A4U43_C02F2910 [Asparagus officinalis] Length = 421 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 122 SNECLVCLDGSRPGYHLQRGFGSGADKWVLHIE 24 + E VCLDGSRPGYHLQRGFGSG D W+LH+E Sbjct: 64 AEEGAVCLDGSRPGYHLQRGFGSGTDNWLLHLE 96 >gb|PHT36337.1| Pectin acetylesterase 4 [Capsicum baccatum] Length = 399 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 38 VCLDGSLPGYHLQKGFGSGSDKWVLHIE 65 >gb|PHU05090.1| Pectin acetylesterase 5 [Capsicum chinense] Length = 263 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 70 CLDGSLPGYHLQKGFGSGSDKWVLHIE 96 >ref|XP_015089241.1| PREDICTED: pectin acetylesterase 5-like [Solanum pennellii] ref|XP_015089242.1| PREDICTED: pectin acetylesterase 5-like [Solanum pennellii] ref|XP_015089243.1| PREDICTED: pectin acetylesterase 5-like [Solanum pennellii] Length = 420 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 67 CLDGSLPGYHLQKGFGSGSDKWVLHIE 93 >ref|XP_004249600.1| PREDICTED: pectin acetylesterase 5 [Solanum lycopersicum] Length = 420 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 67 CLDGSLPGYHLQKGFGSGSDKWVLHIE 93 >gb|PHT70561.1| Pectin acetylesterase 5 [Capsicum annuum] Length = 423 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 70 CLDGSLPGYHLQKGFGSGSDKWVLHIE 96 >ref|XP_016580250.1| PREDICTED: pectin acetylesterase 5-like [Capsicum annuum] ref|XP_016580251.1| PREDICTED: pectin acetylesterase 5-like [Capsicum annuum] Length = 423 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GFGSG+DKWVLHIE Sbjct: 70 CLDGSLPGYHLQKGFGSGSDKWVLHIE 96 >ref|XP_021750735.1| pectin acetylesterase 5-like isoform X1 [Chenopodium quinoa] Length = 421 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYH Q GFGSG+DKWVLHIE Sbjct: 69 CLDGSLPGYHFQNGFGSGSDKWVLHIE 95 >gb|PIA60244.1| hypothetical protein AQUCO_00300035v1 [Aquilegia coerulea] Length = 242 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PG+H Q+GFGSG+D WVLHIE Sbjct: 106 VCLDGSSPGFHFQKGFGSGSDSWVLHIE 133 >gb|PIA60245.1| hypothetical protein AQUCO_00300035v1 [Aquilegia coerulea] Length = 245 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PG+H Q+GFGSG+D WVLHIE Sbjct: 106 VCLDGSSPGFHFQKGFGSGSDSWVLHIE 133 >gb|PIA60243.1| hypothetical protein AQUCO_00300035v1 [Aquilegia coerulea] Length = 250 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PG+H Q+GFGSG+D WVLHIE Sbjct: 106 VCLDGSSPGFHFQKGFGSGSDSWVLHIE 133 >gb|KMZ58047.1| hypothetical protein ZOSMA_7G00760 [Zostera marina] Length = 54 Score = 52.4 bits (124), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 134 DFVRSNECLVCLDGSRPGYHLQRGFGSGADKWVLHIEL 21 D R E VCLDGS P YHL RG+G+GA+ WV+H+E+ Sbjct: 12 DRAREEEA-VCLDGSLPAYHLHRGYGAGANNWVIHLEM 48 >gb|KRH33670.1| hypothetical protein GLYMA_10G139200 [Glycine max] Length = 354 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 110 LVCLDGSRPGYHLQRGFGSGADKWVLHIE 24 LVCLDG+ PGYHL RGFGSGAD W++H+E Sbjct: 2 LVCLDGTVPGYHLDRGFGSGADSWLIHLE 30 >ref|XP_009399871.1| PREDICTED: pectin acetylesterase 5 [Musa acuminata subsp. malaccensis] Length = 435 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PGYHLQRGFGSG D W++H+E Sbjct: 79 VCLDGSPPGYHLQRGFGSGVDSWLVHLE 106 >gb|PIA60246.1| hypothetical protein AQUCO_00300035v1 [Aquilegia coerulea] Length = 308 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PG+H Q+GFGSG+D WVLHIE Sbjct: 106 VCLDGSSPGFHFQKGFGSGSDSWVLHIE 133 >gb|ERN07834.1| hypothetical protein AMTR_s00012p00191170 [Amborella trichopoda] Length = 397 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PGYHLQRGFGSG++ W++HIE Sbjct: 74 VCLDGSAPGYHLQRGFGSGSNYWIVHIE 101 >ref|XP_020523992.1| pectin acetylesterase 5 isoform X2 [Amborella trichopoda] Length = 407 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PGYHLQRGFGSG++ W++HIE Sbjct: 74 VCLDGSAPGYHLQRGFGSGSNYWIVHIE 101 >ref|XP_011624087.1| pectin acetylesterase 5 isoform X3 [Amborella trichopoda] Length = 407 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 107 VCLDGSRPGYHLQRGFGSGADKWVLHIE 24 VCLDGS PGYHLQRGFGSG++ W++HIE Sbjct: 74 VCLDGSAPGYHLQRGFGSGSNYWIVHIE 101 >ref|XP_015165082.1| PREDICTED: pectin acetylesterase 5-like [Solanum tuberosum] Length = 422 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -3 Query: 104 CLDGSRPGYHLQRGFGSGADKWVLHIE 24 CLDGS PGYHLQ+GF SG+DKWVLHIE Sbjct: 69 CLDGSLPGYHLQKGFESGSDKWVLHIE 95