BLASTX nr result
ID: Ophiopogon25_contig00038274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00038274 (831 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269104.1| PREDICTED: uncharacterized protein LOC104605... 57 4e-06 >ref|XP_010269104.1| PREDICTED: uncharacterized protein LOC104605865 [Nelumbo nucifera] Length = 217 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/63 (39%), Positives = 40/63 (63%) Frame = -2 Query: 725 VKISLKINKPLVGTINFPLPDNEDYKLDICYEKLTRFCLFCGCIGHDESRCNYLEELQCA 546 +K++L IN+PLV ++ + L + + + YE+L F LFCG +GH++ C L L+ A Sbjct: 145 IKVALNINEPLVDSVPYTLLSGKTIAIKVKYERLPWFFLFCGRLGHEKGACRTLHRLKLA 204 Query: 545 IED 537 IED Sbjct: 205 IED 207