BLASTX nr result
ID: Ophiopogon25_contig00038089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00038089 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260384.1| uncharacterized protein LOC109836787 [Aspara... 56 7e-06 >ref|XP_020260384.1| uncharacterized protein LOC109836787 [Asparagus officinalis] gb|ONK71300.1| uncharacterized protein A4U43_C04F7050 [Asparagus officinalis] Length = 1151 Score = 56.2 bits (134), Expect = 7e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 422 LPTLG*N*WRS*QILVTPQTTLRANKYMRMHQPEFHHKRVVV 547 LPTL + RS +LVTPQTTL ANK+MR+HQP FHHKR+VV Sbjct: 1031 LPTLYISGGRS--LLVTPQTTLLANKFMRLHQPGFHHKRIVV 1070