BLASTX nr result
ID: Ophiopogon25_contig00038075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00038075 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271245.1| kinesin-like protein KIN-7D, chloroplastic i... 56 2e-06 ref|XP_020271244.1| kinesin-like protein KIN-7D, chloroplastic i... 56 2e-06 >ref|XP_020271245.1| kinesin-like protein KIN-7D, chloroplastic isoform X2 [Asparagus officinalis] Length = 982 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 285 QFFFDEGNFDAEGSMENVTVTVRFRPLSPREIR 383 QFF + NFDAEGS ENVTVTVRFRPLS REIR Sbjct: 56 QFFDESANFDAEGSKENVTVTVRFRPLSQREIR 88 >ref|XP_020271244.1| kinesin-like protein KIN-7D, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK66160.1| uncharacterized protein A4U43_C06F4750 [Asparagus officinalis] Length = 982 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 285 QFFFDEGNFDAEGSMENVTVTVRFRPLSPREIR 383 QFF + NFDAEGS ENVTVTVRFRPLS REIR Sbjct: 56 QFFDESANFDAEGSKENVTVTVRFRPLSQREIR 88