BLASTX nr result
ID: Ophiopogon25_contig00037560
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00037560 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265752.1| 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1... 60 6e-08 >ref|XP_020265752.1| 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 [Asparagus officinalis] Length = 162 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 416 ATPPIK-TISKATAVLDRPLHAFGFEYELISPQKVTGKL 529 ATPP TIS+ATA LDRPL+A GFEYELISPQ+VTG+L Sbjct: 4 ATPPTAATISEATAALDRPLNAIGFEYELISPQRVTGRL 42