BLASTX nr result
ID: Ophiopogon25_contig00037457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00037457 (641 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266425.1| B3 domain-containing protein Os01g0723500-li... 67 4e-10 ref|XP_020266865.1| B3 domain-containing protein Os11g0197600-li... 67 4e-10 ref|XP_020246169.1| B3 domain-containing protein Os11g0197600-li... 62 3e-09 ref|XP_004978926.1| B3 domain-containing protein Os11g0197600 [S... 54 4e-06 ref|XP_020106296.1| B3 domain-containing protein Os11g0197600-li... 56 1e-05 >ref|XP_020266425.1| B3 domain-containing protein Os01g0723500-like isoform X1 [Asparagus officinalis] gb|ONK81691.1| uncharacterized protein A4U43_C01F31900 [Asparagus officinalis] Length = 465 Score = 67.0 bits (162), Expect(2) = 4e-10 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = +1 Query: 424 PSALWGHIVAESGKRVALRGPSGSIWKTRLVKDSEGFVFEDGWKEFVENQAM 579 PSA I ES K V L+G SG IWK LVKD +GFVFEDGWKEFV +Q++ Sbjct: 25 PSAFRERIEVESSKIVYLKGQSGGIWKVGLVKDCDGFVFEDGWKEFVADQSL 76 Score = 25.4 bits (54), Expect(2) = 4e-10 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 378 FFKVFFPNQSTDSL 419 FFKVFFP+QS++ L Sbjct: 9 FFKVFFPDQSSNYL 22 >ref|XP_020266865.1| B3 domain-containing protein Os11g0197600-like isoform X2 [Asparagus officinalis] Length = 455 Score = 67.0 bits (162), Expect(2) = 4e-10 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = +1 Query: 424 PSALWGHIVAESGKRVALRGPSGSIWKTRLVKDSEGFVFEDGWKEFVENQAM 579 PSA I ES K V L+G SG IWK LVKD +GFVFEDGWKEFV +Q++ Sbjct: 25 PSAFRERIEVESSKIVYLKGQSGGIWKVGLVKDCDGFVFEDGWKEFVADQSL 76 Score = 25.4 bits (54), Expect(2) = 4e-10 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 378 FFKVFFPNQSTDSL 419 FFKVFFP+QS++ L Sbjct: 9 FFKVFFPDQSSNYL 22 >ref|XP_020246169.1| B3 domain-containing protein Os11g0197600-like [Asparagus officinalis] gb|ONK58419.1| uncharacterized protein A4U43_C09F12350 [Asparagus officinalis] Length = 415 Score = 62.0 bits (149), Expect(2) = 3e-09 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +1 Query: 424 PSALWGHIVAESGKRVALRGPSGSIWKTRLVKDSEGFVFEDGWKEFVENQAMM 582 P A HI ES +RV L+G SGS+W +VK+ +GF FEDGWK+FV + +++ Sbjct: 25 PPAFGDHIEVESNRRVYLKGQSGSVWGVNMVKNCDGFSFEDGWKDFVVDHSLI 77 Score = 27.3 bits (59), Expect(2) = 3e-09 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 378 FFKVFFPNQSTDSLESFGFVGAH 446 FFK+F PNQS++SL G H Sbjct: 9 FFKIFLPNQSSNSLRIPPAFGDH 31 >ref|XP_004978926.1| B3 domain-containing protein Os11g0197600 [Setaria italica] Length = 475 Score = 53.5 bits (127), Expect(2) = 4e-06 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = +1 Query: 424 PSALWGHIVAESGKRVALRGPSGSIWKTRLVKDSEGFVFEDGWKEFVENQAM 579 P+A H+ + V+L+GPSG+ W+ L DSEG FE GWKEFV + ++ Sbjct: 123 PTAFHQHLKEQPTGLVSLKGPSGNTWQAVLTSDSEGLFFEQGWKEFVTDHSV 174 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +3 Query: 378 FFKVFFPNQSTDSLE 422 FFK+FFP+QS + L+ Sbjct: 107 FFKIFFPDQSRERLK 121 >ref|XP_020106296.1| B3 domain-containing protein Os11g0197600-like isoform X3 [Ananas comosus] Length = 385 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/52 (48%), Positives = 34/52 (65%) Frame = +1 Query: 424 PSALWGHIVAESGKRVALRGPSGSIWKTRLVKDSEGFVFEDGWKEFVENQAM 579 P A H+ ES V+L+GP GSIW LV++S+GF E GWKEFV + ++ Sbjct: 24 PPAFRKHLENESPGMVSLKGPGGSIWNAELVENSQGFRLESGWKEFVADHSL 75