BLASTX nr result
ID: Ophiopogon25_contig00037432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00037432 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244405.1| histone-lysine N-methyltransferase, H3 lysin... 66 2e-09 >ref|XP_020244405.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6-like [Asparagus officinalis] gb|ONK59326.1| uncharacterized protein A4U43_C08F5290 [Asparagus officinalis] Length = 1032 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = -3 Query: 255 KQVGKNTLVNESQDAGIPSGIKISDKVGSSFVGRSADKGAINVPKDGNNLKRKL-LEEGG 79 KQ+G+N V E Q+ +P G K+ DK S + + DK IN+ KDG NLKRK E+G Sbjct: 353 KQLGENLQVKELQETKVPPGTKVEDKEDRSLLNKPVDKRTINILKDGKNLKRKSPKEQGD 412 Query: 78 KSVNAYGDRLKVQSMLAAEKRP 13 + + +G+R V+ ++AAE P Sbjct: 413 EFLEVHGNREIVRGLMAAENCP 434