BLASTX nr result
ID: Ophiopogon25_contig00037421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00037421 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258754.1| H/ACA ribonucleoprotein complex non-core sub... 60 4e-07 >ref|XP_020258754.1| H/ACA ribonucleoprotein complex non-core subunit NAF1-like [Asparagus officinalis] Length = 584 Score = 60.1 bits (144), Expect = 4e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 509 PFGCGNTNPQGIVALGNEQSSGQTPPVVNQGELRPPSMQFNGSRFNPGRSS 357 PFGC +P +AL +EQS Q P VNQGE+RPPSMQ+NG +FN G SS Sbjct: 485 PFGC---DPHCSMALSSEQSYVQAPLFVNQGEMRPPSMQYNGEQFNHGSSS 532