BLASTX nr result
ID: Ophiopogon25_contig00037144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00037144 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258374.1| probable beta-D-xylosidase 2 [Asparagus offi... 100 5e-22 gb|ONK74776.1| uncharacterized protein A4U43_C03F10030 [Asparagu... 99 2e-21 ref|XP_009383787.2| PREDICTED: probable beta-D-xylosidase 2 [Mus... 97 8e-21 ref|XP_008810093.1| PREDICTED: beta-xylosidase/alpha-L-arabinofu... 97 8e-21 gb|OAY62546.1| putative beta-D-xylosidase 2 [Ananas comosus] 97 1e-20 ref|XP_020100023.1| probable beta-D-xylosidase 2 [Ananas comosus] 97 1e-20 gb|KDP42384.1| hypothetical protein JCGZ_02441 [Jatropha curcas] 95 1e-20 ref|XP_023517479.1| probable beta-D-xylosidase 5 [Cucurbita pepo... 96 2e-20 gb|OWM73052.1| hypothetical protein CDL15_Pgr001166 [Punica gran... 96 2e-20 ref|XP_022926343.1| probable beta-D-xylosidase 5 [Cucurbita mosc... 96 3e-20 ref|XP_021907504.1| probable beta-D-xylosidase 5 [Carica papaya] 96 3e-20 ref|XP_012066812.1| probable beta-D-xylosidase 5, partial [Jatro... 95 4e-20 ref|XP_012066816.1| probable beta-D-xylosidase 5 [Jatropha curca... 95 4e-20 ref|XP_016506355.1| PREDICTED: beta-xylosidase/alpha-L-arabinofu... 96 4e-20 gb|POE82321.1| putative beta-d-xylosidase 5 [Quercus suber] 96 4e-20 gb|KDP43295.1| hypothetical protein JCGZ_24216 [Jatropha curcas] 95 4e-20 ref|XP_012065820.1| probable beta-D-xylosidase 5 [Jatropha curcas] 95 4e-20 ref|XP_016483678.1| PREDICTED: probable beta-D-xylosidase 5 [Nic... 95 5e-20 ref|XP_009802500.1| PREDICTED: probable beta-D-xylosidase 5 isof... 95 5e-20 ref|XP_009603777.1| PREDICTED: probable beta-D-xylosidase 5 isof... 95 5e-20 >ref|XP_020258374.1| probable beta-D-xylosidase 2 [Asparagus officinalis] Length = 806 Score = 100 bits (250), Expect = 5e-22 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDI 252 AM+NLGHTYLTFWSPVINV RDPR G+IMETPGED F IG+YSVNFVRGLQD+ Sbjct: 168 AMYNLGHTYLTFWSPVINVARDPRWGRIMETPGEDAFTIGKYSVNFVRGLQDV 220 >gb|ONK74776.1| uncharacterized protein A4U43_C03F10030 [Asparagus officinalis] Length = 638 Score = 99.4 bits (246), Expect = 2e-21 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 407 MFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDI 252 M+NLGHTYLTFWSPVINV RDPR G+IMETPGED F IG+YSVNFVRGLQD+ Sbjct: 1 MYNLGHTYLTFWSPVINVARDPRWGRIMETPGEDAFTIGKYSVNFVRGLQDV 52 >ref|XP_009383787.2| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. malaccensis] Length = 727 Score = 97.4 bits (241), Expect = 8e-21 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLGHT L FWSP +NVVRDPR G+++ETPGEDPFV+GRY+VNFVRG+QD+ T++ Sbjct: 82 AMYNLGHTGLNFWSPNVNVVRDPRWGRVLETPGEDPFVVGRYAVNFVRGMQDVEGTEN 139 >ref|XP_008810093.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like [Phoenix dactylifera] Length = 820 Score = 97.4 bits (241), Expect = 8e-21 Identities = 42/57 (73%), Positives = 52/57 (91%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETK 240 AM+NLGH+ LTFWSP INVVRDPR G+ +ETPGEDPF+IGRY++NFVRGLQD+ +T+ Sbjct: 176 AMYNLGHSGLTFWSPNINVVRDPRWGRALETPGEDPFMIGRYAINFVRGLQDVEQTE 232 >gb|OAY62546.1| putative beta-D-xylosidase 2 [Ananas comosus] Length = 830 Score = 97.1 bits (240), Expect = 1e-20 Identities = 41/59 (69%), Positives = 52/59 (88%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKST 234 AM+NLGHT LTFWSP INV RDPR G+++ETPGEDP+ +GRYSVNFVRG+QD+ +++T Sbjct: 184 AMYNLGHTGLTFWSPNINVARDPRWGRVLETPGEDPYTVGRYSVNFVRGMQDVQGSETT 242 >ref|XP_020100023.1| probable beta-D-xylosidase 2 [Ananas comosus] Length = 833 Score = 97.1 bits (240), Expect = 1e-20 Identities = 41/59 (69%), Positives = 52/59 (88%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKST 234 AM+NLGHT LTFWSP INV RDPR G+++ETPGEDP+ +GRYSVNFVRG+QD+ +++T Sbjct: 187 AMYNLGHTGLTFWSPNINVARDPRWGRVLETPGEDPYTVGRYSVNFVRGMQDVQGSETT 245 >gb|KDP42384.1| hypothetical protein JCGZ_02441 [Jatropha curcas] Length = 349 Score = 95.1 bits (235), Expect = 1e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLG LTFWSPVINVVRDPR G+++ETPGEDPF++GRY+ NFVRGLQD+ T++ Sbjct: 171 AMYNLGRAGLTFWSPVINVVRDPRWGRVIETPGEDPFIVGRYASNFVRGLQDVEGTEN 228 >ref|XP_023517479.1| probable beta-D-xylosidase 5 [Cucurbita pepo subsp. pepo] Length = 721 Score = 96.3 bits (238), Expect = 2e-20 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AMFNLG + LTFWSP INVVRDPR G+I+ETPGEDPFV+G+Y+VN+VRGLQD+ T++ Sbjct: 82 AMFNLGRSGLTFWSPTINVVRDPRWGRILETPGEDPFVVGKYAVNYVRGLQDVEGTEN 139 >gb|OWM73052.1| hypothetical protein CDL15_Pgr001166 [Punica granatum] Length = 763 Score = 96.3 bits (238), Expect = 2e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLGH LTFWSP INVVRDPR G+ +ETPGEDPFV GRY+VN+VRGLQD+ E +S Sbjct: 126 AMYNLGHAGLTFWSPNINVVRDPRWGRALETPGEDPFVAGRYAVNYVRGLQDVEEAES 183 >ref|XP_022926343.1| probable beta-D-xylosidase 5 [Cucurbita moschata] Length = 721 Score = 95.9 bits (237), Expect = 3e-20 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AMFNLG LTFWSP INVVRDPR G+I+ETPGEDPFV+G+Y+VN+VRGLQD+ T++ Sbjct: 82 AMFNLGRAGLTFWSPTINVVRDPRWGRILETPGEDPFVVGKYAVNYVRGLQDVEGTEN 139 >ref|XP_021907504.1| probable beta-D-xylosidase 5 [Carica papaya] Length = 777 Score = 95.9 bits (237), Expect = 3e-20 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETK 240 AM+NLG LTFWSPVINVVRDPR G+I ETPGEDPFV+GRY+ NFVRGLQD+ T+ Sbjct: 135 AMYNLGRAGLTFWSPVINVVRDPRWGRIQETPGEDPFVVGRYAANFVRGLQDVRGTE 191 >ref|XP_012066812.1| probable beta-D-xylosidase 5, partial [Jatropha curcas] Length = 469 Score = 95.1 bits (235), Expect = 4e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLG LTFWSPVINVVRDPR G+++ETPGEDPF++GRY+ NFVRGLQD+ T++ Sbjct: 171 AMYNLGRAGLTFWSPVINVVRDPRWGRVIETPGEDPFIVGRYASNFVRGLQDVEGTEN 228 >ref|XP_012066816.1| probable beta-D-xylosidase 5 [Jatropha curcas] gb|KDP42389.1| hypothetical protein JCGZ_02446 [Jatropha curcas] Length = 471 Score = 95.1 bits (235), Expect = 4e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLG LTFWSPVINVVRDPR G+++ETPGEDPF++GRY+ NFVRGLQD+ T++ Sbjct: 169 AMYNLGRAGLTFWSPVINVVRDPRWGRVIETPGEDPFIVGRYASNFVRGLQDVEGTEN 226 >ref|XP_016506355.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like [Nicotiana tabacum] Length = 803 Score = 95.5 bits (236), Expect = 4e-20 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKSTV 231 AMFNLGH LTFWSP INVVRDPR G+++ETPGEDPFV+G+Y+ N+VRGLQD+ + S Sbjct: 168 AMFNLGHAGLTFWSPNINVVRDPRWGRVLETPGEDPFVVGKYASNYVRGLQDVEDLNSRP 227 Query: 230 CK 225 K Sbjct: 228 LK 229 >gb|POE82321.1| putative beta-d-xylosidase 5 [Quercus suber] Length = 1142 Score = 95.5 bits (236), Expect = 4e-20 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 4/76 (5%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKSTV 231 A++NLGH LTFWSP INV RDPR G+I+ETPGEDPFV+G Y+VN+VRGLQD+ T++ Sbjct: 634 ALYNLGHVGLTFWSPTINVARDPRWGRIIETPGEDPFVVGTYAVNYVRGLQDVEGTENNK 693 Query: 230 CKCV*TK----STVCK 195 K + ++ ST CK Sbjct: 694 YKDLYSRPLKVSTCCK 709 Score = 92.0 bits (227), Expect = 6e-19 Identities = 41/62 (66%), Positives = 49/62 (79%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKSTV 231 A+ NLGH LTFWSP INV RDPR G+I+ETPGEDPFV+G Y+ N+VRGLQD+ T+S Sbjct: 150 ALHNLGHAGLTFWSPTINVARDPRWGRIIETPGEDPFVVGTYAANYVRGLQDVEGTESNK 209 Query: 230 CK 225 K Sbjct: 210 YK 211 >gb|KDP43295.1| hypothetical protein JCGZ_24216 [Jatropha curcas] Length = 493 Score = 95.1 bits (235), Expect = 4e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLG LTFWSPVINVVRDPR G+++ETPGEDPF++GRY+ NFVRGLQD+ T++ Sbjct: 171 AMYNLGRAGLTFWSPVINVVRDPRWGRVIETPGEDPFIVGRYASNFVRGLQDVEGTEN 228 >ref|XP_012065820.1| probable beta-D-xylosidase 5 [Jatropha curcas] Length = 513 Score = 95.1 bits (235), Expect = 4e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AM+NLG LTFWSPVINVVRDPR G+++ETPGEDPF++GRY+ NFVRGLQD+ T++ Sbjct: 171 AMYNLGRAGLTFWSPVINVVRDPRWGRVIETPGEDPFIVGRYASNFVRGLQDVEGTEN 228 >ref|XP_016483678.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tabacum] Length = 695 Score = 95.1 bits (235), Expect = 5e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AMFNLGH LTFWSP INVVRDPR G+++ETPGEDPFV+G+Y+ N+VRGLQD+ T++ Sbjct: 168 AMFNLGHAGLTFWSPNINVVRDPRWGRVLETPGEDPFVVGKYASNYVRGLQDVEGTEN 225 >ref|XP_009802500.1| PREDICTED: probable beta-D-xylosidase 5 isoform X2 [Nicotiana sylvestris] Length = 695 Score = 95.1 bits (235), Expect = 5e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AMFNLGH LTFWSP INVVRDPR G+++ETPGEDPFV+G+Y+ N+VRGLQD+ T++ Sbjct: 168 AMFNLGHAGLTFWSPNINVVRDPRWGRVLETPGEDPFVVGKYASNYVRGLQDVEGTEN 225 >ref|XP_009603777.1| PREDICTED: probable beta-D-xylosidase 5 isoform X2 [Nicotiana tomentosiformis] Length = 695 Score = 95.1 bits (235), Expect = 5e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 410 AMFNLGHTYLTFWSPVINVVRDPR*GKIMETPGEDPFVIGRYSVNFVRGLQDINETKS 237 AMFNLGH LTFWSP INVVRDPR G+++ETPGEDPFV+G+Y+ N+VRGLQD+ T++ Sbjct: 168 AMFNLGHAGLTFWSPNINVVRDPRWGRVLETPGEDPFVVGKYASNYVRGLQDVEGTEN 225