BLASTX nr result
ID: Ophiopogon25_contig00036216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00036216 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275033.1| pentatricopeptide repeat-containing protein ... 107 1e-29 ref|XP_010921395.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-19 ref|XP_017696800.1| PREDICTED: pentatricopeptide repeat-containi... 95 4e-19 ref|XP_009391518.2| PREDICTED: pentatricopeptide repeat-containi... 90 2e-17 ref|XP_020107923.1| pentatricopeptide repeat-containing protein ... 87 2e-16 ref|XP_020676586.1| pentatricopeptide repeat-containing protein ... 82 7e-15 gb|PKA46791.1| Pentatricopeptide repeat-containing protein [Apos... 82 1e-14 ref|XP_020587914.1| pentatricopeptide repeat-containing protein ... 70 2e-10 gb|OVA11230.1| Pentatricopeptide repeat [Macleaya cordata] 64 1e-08 ref|XP_006658163.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 gb|EEC82719.1| hypothetical protein OsI_27404 [Oryza sativa Indi... 60 5e-07 gb|PAN15516.1| hypothetical protein PAHAL_B05005 [Panicum hallii... 59 9e-07 gb|KMZ65631.1| putative Pentatricopeptide repeat-containing prot... 59 9e-07 ref|XP_004967498.1| pentatricopeptide repeat-containing protein ... 58 2e-06 ref|XP_015647579.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006836595.3| pentatricopeptide repeat-containing protein ... 57 6e-06 gb|ERM99448.1| hypothetical protein AMTR_s00131p00098210 [Ambore... 57 6e-06 ref|XP_020518775.1| pentatricopeptide repeat-containing protein ... 57 6e-06 >ref|XP_020275033.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Asparagus officinalis] ref|XP_020275034.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Asparagus officinalis] gb|ONK63236.1| uncharacterized protein A4U43_C07F12790 [Asparagus officinalis] Length = 659 Score = 107 bits (266), Expect(2) = 1e-29 Identities = 53/69 (76%), Positives = 60/69 (86%) Frame = -1 Query: 211 KKASSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDS 32 ++ S+LF+LP PSFA SSRRL+R L S+KWSESVEMEL KLNV LN YVVNQV+KSLSDS Sbjct: 40 REVSNLFKLPSPSFAVSSRRLKRVLRSNKWSESVEMELGKLNVQLNNYVVNQVLKSLSDS 99 Query: 31 EMAFHFYLW 5 EMAF FYLW Sbjct: 100 EMAFRFYLW 108 Score = 50.4 bits (119), Expect(2) = 1e-29 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -3 Query: 335 MIWASPRFCGRSRYFTVKSLAISLSCFSSQTHIANPSKS 219 MI AS + CG SR+ VKSLA+S SCFSS+T I N S+S Sbjct: 1 MICASHKICGHSRFLMVKSLALSFSCFSSKTQITNSSES 39 >ref|XP_010921395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Elaeis guineensis] ref|XP_010921396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Elaeis guineensis] Length = 680 Score = 95.9 bits (237), Expect = 2e-19 Identities = 46/70 (65%), Positives = 58/70 (82%) Frame = -1 Query: 211 KKASSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDS 32 K S +F+ P+FA SS R+ RAL S+KWSESVEMELQ+L+VHLNTY+VNQV+KSLS+S Sbjct: 46 KNLSEIFKPTAPTFADSSSRIRRALQSNKWSESVEMELQRLDVHLNTYIVNQVLKSLSNS 105 Query: 31 EMAFHFYLWA 2 E AF F++WA Sbjct: 106 ETAFLFFVWA 115 >ref|XP_017696800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Phoenix dactylifera] ref|XP_017696801.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Phoenix dactylifera] ref|XP_017696802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Phoenix dactylifera] Length = 670 Score = 94.7 bits (234), Expect = 4e-19 Identities = 45/70 (64%), Positives = 58/70 (82%) Frame = -1 Query: 211 KKASSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDS 32 K S +F+ P+FA SS R+ RAL S+KWSESVEMELQ+L+V LNTY+VNQV+KSLS+S Sbjct: 46 KNLSEIFKPTAPTFAESSSRIRRALQSNKWSESVEMELQRLDVDLNTYIVNQVLKSLSNS 105 Query: 31 EMAFHFYLWA 2 + AFHF++WA Sbjct: 106 KTAFHFFVWA 115 >ref|XP_009391518.2| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Musa acuminata subsp. malaccensis] Length = 676 Score = 90.1 bits (222), Expect = 2e-17 Identities = 44/69 (63%), Positives = 53/69 (76%) Frame = -1 Query: 208 KASSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSE 29 K S+ F+ P +F SS RL R L SSKWSES E+ELQ+LN+ LNTY+ NQV+KSLSDS Sbjct: 48 KLSARFKSPTHAFLESSCRLRRVLESSKWSESTEIELQRLNIELNTYIANQVLKSLSDSY 107 Query: 28 MAFHFYLWA 2 MA+ FYLWA Sbjct: 108 MAYRFYLWA 116 >ref|XP_020107923.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Ananas comosus] ref|XP_020107924.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Ananas comosus] ref|XP_020107925.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Ananas comosus] Length = 659 Score = 87.0 bits (214), Expect = 2e-16 Identities = 45/87 (51%), Positives = 59/87 (67%), Gaps = 5/87 (5%) Frame = -1 Query: 247 KPTSPIPQNPLI-----KKASSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNV 83 +P S I Q+ K S LFQ P P+++ S+ ++ R L ++WSESV MEL++L V Sbjct: 23 RPVSAITQSGFFSSESRKNLSELFQPPAPAYSDSACQIGRILQCNQWSESVAMELERLGV 82 Query: 82 HLNTYVVNQVVKSLSDSEMAFHFYLWA 2 LN YVVNQV+KSLSDS +AFHFY WA Sbjct: 83 ELNPYVVNQVLKSLSDSALAFHFYWWA 109 >ref|XP_020676586.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Dendrobium catenatum] gb|PKU69561.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 692 Score = 82.4 bits (202), Expect = 7e-15 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -1 Query: 202 SSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMA 23 SSLF P PSFA S RL AL S +WS+ VEMELQ +++ LN Y VNQV+K L +SE+ Sbjct: 48 SSLFGRPKPSFAESYLRLTTALQSGRWSKEVEMELQSIDIVLNNYAVNQVLKGLPNSEIG 107 Query: 22 FHFYLWA 2 FHF+LWA Sbjct: 108 FHFFLWA 114 >gb|PKA46791.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 677 Score = 82.0 bits (201), Expect = 1e-14 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = -1 Query: 202 SSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMA 23 S LF+ PSFA S+ +L RAL+S WS++VEMEL LN+ LN YVVNQV+K LSDSE+ Sbjct: 51 SKLFRESRPSFAESTFQLRRALMSGGWSKAVEMELGILNIVLNNYVVNQVLKGLSDSELG 110 Query: 22 FHFYLWA 2 F F+LWA Sbjct: 111 FQFFLWA 117 >ref|XP_020587914.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Phalaenopsis equestris] ref|XP_020587915.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Phalaenopsis equestris] ref|XP_020587916.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Phalaenopsis equestris] ref|XP_020587917.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Phalaenopsis equestris] Length = 695 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = -1 Query: 202 SSLFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMA 23 SSLF PS A S L AL S WS +VE+EL+ LN+ LN Y VNQV+K+L +SEM Sbjct: 66 SSLFASQKPSSAKSYLSLRTALQSGIWSNNVELELRSLNIVLNNYAVNQVLKALPNSEMG 125 Query: 22 FHFYLWA 2 F F++WA Sbjct: 126 FCFFMWA 132 >gb|OVA11230.1| Pentatricopeptide repeat [Macleaya cordata] Length = 721 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 127 KWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 +WS+ VEMEL KL+V LNTY VNQV+KSLSDSE+ F FY WA Sbjct: 48 QWSDLVEMELYKLDVELNTYSVNQVLKSLSDSEIGFCFYTWA 89 >ref|XP_006658163.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Oryza brachyantha] ref|XP_015694858.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Oryza brachyantha] Length = 664 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/65 (50%), Positives = 45/65 (69%) Frame = -1 Query: 196 LFQLPPPSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFH 17 L +L P +S + RAL +WSESVE+EL+ L+V L+ +VVN+V++ LSDSEMA Sbjct: 49 LSELFRPVRTDTSGVIGRALECGRWSESVELELEGLHVDLDPFVVNRVLRGLSDSEMAVR 108 Query: 16 FYLWA 2 FY WA Sbjct: 109 FYWWA 113 >gb|EEC82719.1| hypothetical protein OsI_27404 [Oryza sativa Indica Group] Length = 665 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -1 Query: 145 RALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 RAL +WSESVE+EL+ L+V L+ +VVN+V++ LSDS MA FY WA Sbjct: 68 RALECGRWSESVELELEGLHVELDPFVVNKVLRGLSDSGMAVRFYWWA 115 >gb|PAN15516.1| hypothetical protein PAHAL_B05005 [Panicum hallii] gb|PAN15517.1| hypothetical protein PAHAL_B05005 [Panicum hallii] Length = 662 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/53 (50%), Positives = 39/53 (73%) Frame = -1 Query: 160 SRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 S + RAL +WS S+E+EL++L+V L+ +VVN+V++ LSDSE A FY WA Sbjct: 60 SYAIGRALEQGRWSHSMELELERLHVDLDPFVVNRVLRGLSDSETAVRFYWWA 112 >gb|KMZ65631.1| putative Pentatricopeptide repeat-containing protein [Zostera marina] Length = 666 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/71 (40%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 202 SSLFQLPPPSFAGSSRRLERALIS----SKWSESVEMELQKLNVHLNTYVVNQVVKSLSD 35 S LF+ P ++ S ++ + + + +KWSESVE+ELQK LNTY+V+QV+ ++++ Sbjct: 40 SPLFKKRMPQYSKESDQVIKVIRTLQHQTKWSESVELELQKYVADLNTYIVSQVLMNMTN 99 Query: 34 SEMAFHFYLWA 2 +MA FY WA Sbjct: 100 VDMALRFYFWA 110 >ref|XP_004967498.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Setaria italica] gb|KQL03392.1| hypothetical protein SETIT_004622mg [Setaria italica] Length = 662 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/59 (45%), Positives = 42/59 (71%) Frame = -1 Query: 178 PSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 P+ +S + +AL +WS+SVE+EL++L+V L+ +VVN V++ +SDSE A FY WA Sbjct: 54 PARVHASSVIGQALERGRWSDSVELELERLHVDLDPFVVNLVLRGVSDSETAVRFYWWA 112 >ref|XP_015647579.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Oryza sativa Japonica Group] ref|XP_015647581.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Oryza sativa Japonica Group] ref|XP_015647582.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Oryza sativa Japonica Group] dbj|BAC79597.1| membrane-associated salt-inducible protein-like [Oryza sativa Japonica Group] dbj|BAD30301.1| membrane-associated salt-inducible protein-like [Oryza sativa Japonica Group] dbj|BAF22613.1| Os07g0688100 [Oryza sativa Japonica Group] dbj|BAG95163.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEE67851.1| hypothetical protein OsJ_25651 [Oryza sativa Japonica Group] dbj|BAT03311.1| Os07g0688100 [Oryza sativa Japonica Group] Length = 665 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -1 Query: 145 RALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 RAL +WSESVE+EL+ L+V L+ +VVN+V++ L DS MA FY WA Sbjct: 68 RALECGRWSESVELELEGLHVELDPFVVNKVLRGLLDSGMAVRFYWWA 115 >ref|XP_006836595.3| pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X2 [Amborella trichopoda] Length = 701 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/59 (44%), Positives = 38/59 (64%) Frame = -1 Query: 178 PSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 P + ++ R+++ L KWS VE EL +L V LNTY+ NQV+K +DS + F F+ WA Sbjct: 84 PLYLPAALRIQKVLKVGKWSVDVERELNELYVSLNTYIANQVLKVETDSLLGFSFFCWA 142 >gb|ERM99448.1| hypothetical protein AMTR_s00131p00098210 [Amborella trichopoda] Length = 704 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/59 (44%), Positives = 38/59 (64%) Frame = -1 Query: 178 PSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 P + ++ R+++ L KWS VE EL +L V LNTY+ NQV+K +DS + F F+ WA Sbjct: 70 PLYLPAALRIQKVLKVGKWSVDVERELNELYVSLNTYIANQVLKVETDSLLGFSFFCWA 128 >ref|XP_020518775.1| pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X1 [Amborella trichopoda] Length = 719 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/59 (44%), Positives = 38/59 (64%) Frame = -1 Query: 178 PSFAGSSRRLERALISSKWSESVEMELQKLNVHLNTYVVNQVVKSLSDSEMAFHFYLWA 2 P + ++ R+++ L KWS VE EL +L V LNTY+ NQV+K +DS + F F+ WA Sbjct: 84 PLYLPAALRIQKVLKVGKWSVDVERELNELYVSLNTYIANQVLKVETDSLLGFSFFCWA 142