BLASTX nr result
ID: Ophiopogon25_contig00036027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00036027 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75330.1| uncharacterized protein A4U43_C03F15720 [Asparagu... 68 2e-12 >gb|ONK75330.1| uncharacterized protein A4U43_C03F15720 [Asparagus officinalis] Length = 97 Score = 68.2 bits (165), Expect = 2e-12 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 7 RVKWLGFKTLKPEEAKQAKPCSVGVFIDGNQWLPSTGVPFD 129 RV+W GFK L+ +E + KP SVGVFIDGN+WLPSTGVPFD Sbjct: 41 RVRWPGFKALQADEGGEVKPFSVGVFIDGNEWLPSTGVPFD 81