BLASTX nr result
ID: Ophiopogon25_contig00035954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035954 (914 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275946.1| probable WRKY transcription factor 2 isoform... 64 9e-08 ref|XP_020275796.1| probable WRKY transcription factor 2 isoform... 64 9e-08 >ref|XP_020275946.1| probable WRKY transcription factor 2 isoform X2 [Asparagus officinalis] gb|ONK81995.1| uncharacterized protein A4U43_C01F35030 [Asparagus officinalis] Length = 584 Score = 64.3 bits (155), Expect = 9e-08 Identities = 41/80 (51%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +2 Query: 677 MSPNPSQRNFFSSLMAEEFDPKSFSNGDEGPFLKSKEDDNVMDHKGEEGDGGRLQFSTDL 856 M +PS +NFFS+LMAEEFDP S SNG N + HK E+GD R Sbjct: 1 MPLSPSHKNFFSNLMAEEFDPDSSSNG------------NDLIHKDEKGDDVR------- 41 Query: 857 STKPNSV-NAHKPSLTERRA 913 +KP SV N HKPSLTERRA Sbjct: 42 PSKPTSVNNGHKPSLTERRA 61 >ref|XP_020275796.1| probable WRKY transcription factor 2 isoform X1 [Asparagus officinalis] ref|XP_020275870.1| probable WRKY transcription factor 2 isoform X1 [Asparagus officinalis] Length = 585 Score = 64.3 bits (155), Expect = 9e-08 Identities = 41/80 (51%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +2 Query: 677 MSPNPSQRNFFSSLMAEEFDPKSFSNGDEGPFLKSKEDDNVMDHKGEEGDGGRLQFSTDL 856 M +PS +NFFS+LMAEEFDP S SNG N + HK E+GD R Sbjct: 1 MPLSPSHKNFFSNLMAEEFDPDSSSNG------------NDLIHKDEKGDDVR------- 41 Query: 857 STKPNSV-NAHKPSLTERRA 913 +KP SV N HKPSLTERRA Sbjct: 42 PSKPTSVNNGHKPSLTERRA 61