BLASTX nr result
ID: Ophiopogon25_contig00035885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035885 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42133.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 55 4e-06 >dbj|GBC42133.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 207 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = -3 Query: 396 DSDKILDPPASKCKGRPRN-RFKSPQDNYIASKKRVAGSIFVVKNDQDTDGENASKRTRT 220 DS KIL+P K KGRPRN RFKS + S K + F+ N+ G K ++T Sbjct: 118 DSRKILNPYMVKSKGRPRNKRFKSSVETCKNSSKGTGSNAFIQDNNGHEGGSLQGKGSKT 177 Query: 219 CSKCGTQGHDVRTC 178 CS C H++R C Sbjct: 178 CSNCYAPNHNIRRC 191