BLASTX nr result
ID: Ophiopogon25_contig00035840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035840 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY73194.1| Protein FAR1-RELATED SEQUENCE 12, partial [Ananas... 58 6e-08 gb|OAY81145.1| Protein FAR1-RELATED SEQUENCE 12, partial [Ananas... 57 4e-07 >gb|OAY73194.1| Protein FAR1-RELATED SEQUENCE 12, partial [Ananas comosus] Length = 97 Score = 57.8 bits (138), Expect = 6e-08 Identities = 28/73 (38%), Positives = 43/73 (58%) Frame = -1 Query: 221 NDETAVDNSCFMDMENSEAILGRESVFPCEEVDGIVQEPTKGMEFKSLEEGRAYYDRYAH 42 N + ++D +++E E + E V+ EE D EP G EF SLEE + +Y++YA Sbjct: 18 NADASIDEFNIVEIEELEEKIPSEQVYETEEKDS---EPYLGQEFSSLEEAKNFYNKYAF 74 Query: 41 RIGFSTRKGTHYK 3 + GFS RK +HY+ Sbjct: 75 KTGFSIRKSSHYR 87 >gb|OAY81145.1| Protein FAR1-RELATED SEQUENCE 12, partial [Ananas comosus] Length = 151 Score = 57.0 bits (136), Expect = 4e-07 Identities = 29/73 (39%), Positives = 41/73 (56%) Frame = -1 Query: 221 NDETAVDNSCFMDMENSEAILGRESVFPCEEVDGIVQEPTKGMEFKSLEEGRAYYDRYAH 42 N + ++D +++E E + E V+ EE D EP G EF SLEE +Y++YA Sbjct: 18 NADASIDEFTIVEIEELEEDIPSEQVYETEETDS---EPYIGQEFSSLEEAGNFYNKYAF 74 Query: 41 RIGFSTRKGTHYK 3 + FS RK THYK Sbjct: 75 KTRFSIRKSTHYK 87