BLASTX nr result
ID: Ophiopogon25_contig00035803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035803 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC22551.1| Tis13_1301: PROVISIONAL [Rhizophagus irregularis... 55 3e-07 gb|POG62320.1| hypothetical protein GLOIN_2v1785467 [Rhizophagus... 54 7e-07 dbj|GBC47988.1| Tis13_1310 [Rhizophagus irregularis DAOM 181602] 53 2e-06 >dbj|GBC22551.1| Tis13_1301: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 54 Score = 54.7 bits (130), Expect = 3e-07 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +2 Query: 74 MNP-IISSKPVVIVTSEATEKP-GNPTNSCSIM*NASLL*KKFLLYN 208 MNP II+SKP+VI+TSE TEKP GNPTNSCSI+ N ++ + L N Sbjct: 1 MNPTIITSKPIVIITSEVTEKPDGNPTNSCSIIFNQKIIPNDYSLRN 47 >gb|POG62320.1| hypothetical protein GLOIN_2v1785467 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 80 Score = 54.3 bits (129), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 74 MNP-IISSKPVVIVTSEATEKPGNPTNSCSIM 166 MNP II+SKP+VIV SE TEKPGNPTNSCSI+ Sbjct: 1 MNPTIITSKPIVIVASEVTEKPGNPTNSCSII 32 >dbj|GBC47988.1| Tis13_1310 [Rhizophagus irregularis DAOM 181602] Length = 75 Score = 52.8 bits (125), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 74 MNP-IISSKPVVIVTSEATEKP-GNPTNSCSIM 166 MNP II+SKP+VIVTSE TEKP GNPTNSCSIM Sbjct: 1 MNPTIITSKPIVIVTSEITEKPDGNPTNSCSIM 33