BLASTX nr result
ID: Ophiopogon25_contig00035601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035601 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265996.1| uncharacterized protein LOC109841436 [Aspara... 65 1e-10 >ref|XP_020265996.1| uncharacterized protein LOC109841436 [Asparagus officinalis] Length = 134 Score = 64.7 bits (156), Expect = 1e-10 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = -3 Query: 400 RNEINTGADISGVGKCGHGE-ERELSLECVLMSNRGLMGNRGLASRLSLVGLIPFSSDYH 224 +N +NTGA++S V KC GE +R LSL CV+M + NRGL + LV +PFSSDY Sbjct: 72 KNGMNTGANLSSVRKCERGENKRVLSLGCVVMGS-----NRGLRPLVGLV--VPFSSDYR 124 Query: 223 VPKGHPPKNN 194 P+ HPPK+N Sbjct: 125 APQRHPPKHN 134