BLASTX nr result
ID: Ophiopogon25_contig00035569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035569 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244170.1| cysteine-rich and transmembrane domain-conta... 52 6e-06 >ref|XP_020244170.1| cysteine-rich and transmembrane domain-containing protein A-like [Asparagus officinalis] Length = 130 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/39 (61%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +1 Query: 133 HYQGPNVVSPPQY---APPPSTGGNASSGAKKGLLAGCI 240 +YQGP V++PPQY PP STG N SGAK G LAGC+ Sbjct: 67 YYQGPPVMAPPQYDYSRPPRSTGSNGGSGAKTGFLAGCL 105