BLASTX nr result
ID: Ophiopogon25_contig00035501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035501 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020081813.1| probable ribosomal protein S11, mitochondria... 74 1e-13 ref|YP_009315970.1| ribosomal protein S11 (mitochondrion) [Cocos... 72 3e-13 ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoen... 72 6e-13 gb|AVL84850.1| ribosomal protein S11 (mitochondrion) [Gastrodia ... 68 1e-11 gb|KQL14457.1| hypothetical protein SETIT_024974mg, partial [Set... 64 2e-09 ref|NP_001148535.1| ribosomal protein S11 containing protein [Ze... 64 3e-09 ref|XP_012699925.1| LOW QUALITY PROTEIN: probable ribosomal prot... 64 3e-09 ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Lirio... 62 4e-09 dbj|BAA12798.1| mitochondrial ribosomal protein S11 [Oryza sativ... 63 4e-09 gb|PAN18262.1| hypothetical protein PAHAL_C02043 [Panicum hallii] 63 5e-09 ref|XP_015628011.1| PREDICTED: probable ribosomal protein S11, m... 63 6e-09 ref|YP_009270687.1| ribosomal protein S11 (mitochondrion) [Nelum... 61 7e-09 gb|AAT85310.1| small subunit ribosomal protein, putative [Oryza ... 63 7e-09 gb|PAN37967.1| hypothetical protein PAHAL_F00845 [Panicum hallii... 62 1e-08 ref|XP_014661071.1| uncharacterized protein LOC106804446 [Setari... 62 1e-08 gb|OEL21122.1| hypothetical protein BAE44_0017859 [Dichanthelium... 62 1e-08 ref|XP_006651450.1| PREDICTED: probable ribosomal protein S11, m... 61 2e-08 ref|XP_015638621.1| PREDICTED: probable ribosomal protein S11, m... 60 3e-08 gb|AVI15767.1| ribosomal protein S11 (mitochondrion) [Nymphaea c... 60 3e-08 ref|XP_021304065.1| probable ribosomal protein S11, mitochondria... 60 4e-08 >ref|XP_020081813.1| probable ribosomal protein S11, mitochondrial [Ananas comosus] Length = 188 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREGFRGEGVG KS I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 143 SWREGFRGEGVGKKSPIMYIHDVTQLPHNGCRLPKKRRV 181 >ref|YP_009315970.1| ribosomal protein S11 (mitochondrion) [Cocos nucifera] gb|AOX12964.1| ribosomal protein S11 (mitochondrion) [Cocos nucifera] Length = 149 Score = 72.0 bits (175), Expect = 3e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREGFRGEGVG +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 104 SWREGFRGEGVGDQSPIMYIHDVTQLPHNGCRLPKKRRV 142 >ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] gb|AEM43925.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] Length = 171 Score = 72.0 bits (175), Expect = 6e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREGFRGEGVG +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 104 SWREGFRGEGVGDQSPIMYIHDVTQLPHNGCRLPKKRRV 142 >gb|AVL84850.1| ribosomal protein S11 (mitochondrion) [Gastrodia elata] Length = 153 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREGFRG GVG +S IL I+DVTQL HNGCRLPK+RRV Sbjct: 108 SWREGFRGSGVGDQSTILYIHDVTQLSHNGCRLPKKRRV 146 >gb|KQL14457.1| hypothetical protein SETIT_024974mg, partial [Setaria italica] Length = 199 Score = 63.5 bits (153), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 WREGFRGE V +S I+ I+DVTQLPHNGCR PKQRRV Sbjct: 162 WREGFRGERVRDQSPIMYIHDVTQLPHNGCRRPKQRRV 199 >ref|NP_001148535.1| ribosomal protein S11 containing protein [Zea mays] ref|XP_020397719.1| ribosomal protein S11 containing protein isoform X1 [Zea mays] gb|ACG31875.1| ribosomal protein S11 containing protein [Zea mays] gb|ACN31110.1| unknown [Zea mays] gb|AQK91967.1| putative ribosomal protein S11 mitochondrial [Zea mays] gb|AQK91968.1| putative ribosomal protein S11 mitochondrial [Zea mays] Length = 252 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S I+ I+DVTQLPHNGCRLPKQRRV Sbjct: 214 SFREGFRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 252 >ref|XP_012699925.1| LOW QUALITY PROTEIN: probable ribosomal protein S11, mitochondrial [Setaria italica] Length = 263 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 WREGFRGE V +S I+ I+DVTQLPHNGCR PKQRRV Sbjct: 226 WREGFRGERVRDQSPIMYIHDVTQLPHNGCRRPKQRRV 263 >ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] gb|AGJ90415.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] Length = 172 Score = 62.0 bits (149), Expect = 4e-09 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 6/45 (13%) Frame = -1 Query: 422 SWREGF------RGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREG+ R EGVG +S+I+ I+DVTQLPHNGCRLP++RRV Sbjct: 127 SWREGYTFAECKRSEGVGDQSQIMYIHDVTQLPHNGCRLPRKRRV 171 >dbj|BAA12798.1| mitochondrial ribosomal protein S11 [Oryza sativa Japonica Group] gb|EAZ27151.1| hypothetical protein OsJ_11086 [Oryza sativa Japonica Group] dbj|BAS84473.1| Os03g0385900 [Oryza sativa Japonica Group] Length = 254 Score = 63.2 bits (152), Expect = 4e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S ++ I+DVTQLPHNGCRLPKQRRV Sbjct: 216 SFREGFRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 254 >gb|PAN18262.1| hypothetical protein PAHAL_C02043 [Panicum hallii] Length = 291 Score = 63.2 bits (152), Expect = 5e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREGFR E V +S I I+DVTQLPHNGCRLPKQRRV Sbjct: 253 SWREGFRWERVRDQSPITYIHDVTQLPHNGCRLPKQRRV 291 >ref|XP_015628011.1| PREDICTED: probable ribosomal protein S11, mitochondrial [Oryza sativa Japonica Group] gb|ABF96308.1| ribosomal protein S11 containing protein, expressed [Oryza sativa Japonica Group] dbj|BAF12167.1| Os03g0385900 [Oryza sativa Japonica Group] dbj|BAG93238.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS84472.1| Os03g0385900 [Oryza sativa Japonica Group] Length = 332 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S ++ I+DVTQLPHNGCRLPKQRRV Sbjct: 294 SFREGFRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 332 >ref|YP_009270687.1| ribosomal protein S11 (mitochondrion) [Nelumbo nucifera] gb|ALL55140.1| ribosomal protein S11 (mitochondrion) [Nelumbo nucifera] Length = 148 Score = 60.8 bits (146), Expect = 7e-09 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 6/45 (13%) Frame = -1 Query: 422 SWREGF------RGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 SWREG+ R +GVG +S+I+ I+DVTQLPHNGCRLP++RRV Sbjct: 103 SWREGYTFAECKRSKGVGDQSKIMYIHDVTQLPHNGCRLPRKRRV 147 >gb|AAT85310.1| small subunit ribosomal protein, putative [Oryza sativa Japonica Group] Length = 366 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S ++ I+DVTQLPHNGCRLPKQRRV Sbjct: 328 SFREGFRGERVREQSPVVLIHDVTQLPHNGCRLPKQRRV 366 >gb|PAN37967.1| hypothetical protein PAHAL_F00845 [Panicum hallii] gb|PAN37968.1| hypothetical protein PAHAL_F00845 [Panicum hallii] Length = 261 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 +REGFRGE V +S I+ I+DVTQLPHNGCRLPKQRRV Sbjct: 224 FREGFRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 261 >ref|XP_014661071.1| uncharacterized protein LOC106804446 [Setaria italica] gb|KQK97133.1| hypothetical protein SETIT_010861mg [Setaria italica] Length = 262 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 +REGFRGE V +S I+ I+DVTQLPHNGCRLPKQRRV Sbjct: 225 FREGFRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 262 >gb|OEL21122.1| hypothetical protein BAE44_0017859 [Dichanthelium oligosanthes] Length = 297 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 +REGFRGE V +S I+ I+DVTQLPHNGCRLPKQRRV Sbjct: 260 FREGFRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 297 >ref|XP_006651450.1| PREDICTED: probable ribosomal protein S11, mitochondrial [Oryza brachyantha] Length = 253 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 419 WREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 +REGFRGE V +S ++ I+DVTQLPHNGCRLPKQRR+ Sbjct: 216 FREGFRGERVREQSPVVFIHDVTQLPHNGCRLPKQRRI 253 >ref|XP_015638621.1| PREDICTED: probable ribosomal protein S11, mitochondrial, partial [Oryza sativa Japonica Group] Length = 214 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S ++ I+DVTQLPHNGCRLPKQR V Sbjct: 176 SFREGFRGERVREQSPVVFIHDVTQLPHNGCRLPKQRLV 214 >gb|AVI15767.1| ribosomal protein S11 (mitochondrion) [Nymphaea colorata] Length = 170 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 6/44 (13%) Frame = -1 Query: 422 SWREGF------RGEGVGVKSRILSIYDVTQLPHNGCRLPKQRR 309 SWREG+ R EGVG S I+ I+DVTQLPHNGCRLP++RR Sbjct: 126 SWREGYTFSECKRSEGVGQPSNIMYIHDVTQLPHNGCRLPRKRR 169 >ref|XP_021304065.1| probable ribosomal protein S11, mitochondrial [Sorghum bicolor] gb|KXG22494.1| hypothetical protein SORBI_3009G222900 [Sorghum bicolor] Length = 255 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 422 SWREGFRGEGVGVKSRILSIYDVTQLPHNGCRLPKQRRV 306 S+REGFRGE V +S I+ I+DVTQLPHNGCRL KQRRV Sbjct: 217 SFREGFRGERVRDRSPIMYIHDVTQLPHNGCRLRKQRRV 255