BLASTX nr result
ID: Ophiopogon25_contig00035148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035148 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018675954.1| PREDICTED: 60S ribosomal protein L30-like [M... 57 2e-07 ref|XP_020674695.1| 60S ribosomal protein L30-like [Dendrobium c... 57 3e-07 ref|XP_020585365.1| 60S ribosomal protein L30-like [Phalaenopsis... 57 3e-07 ref|XP_010904747.1| PREDICTED: 60S ribosomal protein L30 [Elaeis... 57 3e-07 ref|XP_009383263.1| PREDICTED: 60S ribosomal protein L30 [Musa a... 57 3e-07 ref|XP_008786753.1| PREDICTED: 60S ribosomal protein L30-like [P... 57 3e-07 ref|XP_020264225.1| 60S ribosomal protein L30 [Asparagus officin... 56 4e-07 gb|PKU80365.1| 60S ribosomal protein L30 [Dendrobium catenatum] 57 8e-07 ref|XP_020693018.1| 60S ribosomal protein L30-like [Dendrobium c... 55 9e-07 ref|XP_020584323.1| 60S ribosomal protein L30 [Phalaenopsis eque... 55 9e-07 ref|XP_008792450.1| PREDICTED: 60S ribosomal protein L30-like [P... 55 9e-07 ref|XP_020680617.1| 60S ribosomal protein L30 [Dendrobium catena... 55 2e-06 gb|PKA66350.1| 60S ribosomal protein L30 [Apostasia shenzhenica] 55 2e-06 ref|XP_010922949.1| PREDICTED: 60S ribosomal protein L30 [Elaeis... 55 2e-06 ref|XP_020102250.1| 60S ribosomal protein L30 [Ananas comosus] >... 54 2e-06 ref|XP_020253647.1| 60S ribosomal protein L30-like [Asparagus of... 54 3e-06 gb|PNT21621.1| hypothetical protein POPTR_009G158700v3 [Populus ... 53 4e-06 ref|XP_020113819.1| 60S ribosomal protein L30-like [Ananas comos... 54 5e-06 ref|XP_008806614.1| PREDICTED: 60S ribosomal protein L30 [Phoeni... 54 5e-06 ref|XP_006379356.1| hypothetical protein POPTR_0009s16030g [Popu... 53 5e-06 >ref|XP_018675954.1| PREDICTED: 60S ribosomal protein L30-like [Musa acuminata subsp. malaccensis] Length = 85 Score = 56.6 bits (135), Expect = 2e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLIIIANNCPPL 55 >ref|XP_020674695.1| 60S ribosomal protein L30-like [Dendrobium catenatum] Length = 112 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLVIIANNCPPL 55 >ref|XP_020585365.1| 60S ribosomal protein L30-like [Phalaenopsis equestris] Length = 112 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLVIIANNCPPL 55 >ref|XP_010904747.1| PREDICTED: 60S ribosomal protein L30 [Elaeis guineensis] Length = 112 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLILIANNCPPL 55 >ref|XP_009383263.1| PREDICTED: 60S ribosomal protein L30 [Musa acuminata subsp. malaccensis] Length = 112 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLIIIANNCPPL 55 >ref|XP_008786753.1| PREDICTED: 60S ribosomal protein L30-like [Phoenix dactylifera] Length = 112 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLIIISNNCPPL 55 >ref|XP_020264225.1| 60S ribosomal protein L30 [Asparagus officinalis] ref|XP_020242492.1| 60S ribosomal protein L30 [Asparagus officinalis] gb|ONK61672.1| uncharacterized protein A4U43_C08F32380 [Asparagus officinalis] gb|ONK69270.1| uncharacterized protein A4U43_C05F21100 [Asparagus officinalis] Length = 112 Score = 56.2 bits (134), Expect = 4e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LGFK VLRSLR+S G N PPL Sbjct: 6 KTKKTTESINNRLALVMKSGKYTLGFKTVLRSLRSSKGKLIIIANNCPPL 55 >gb|PKU80365.1| 60S ribosomal protein L30 [Dendrobium catenatum] Length = 159 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 53 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLVIIANNCPPL 102 >ref|XP_020693018.1| 60S ribosomal protein L30-like [Dendrobium catenatum] ref|XP_020693020.1| 60S ribosomal protein L30-like [Dendrobium catenatum] ref|XP_020693021.1| 60S ribosomal protein L30-like [Dendrobium catenatum] ref|XP_020693022.1| 60S ribosomal protein L30-like [Dendrobium catenatum] gb|PKU69700.1| 60S ribosomal protein L30 [Dendrobium catenatum] gb|PKU69701.1| 60S ribosomal protein L30 [Dendrobium catenatum] Length = 112 Score = 55.5 bits (132), Expect = 9e-07 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRN+ G N PPL Sbjct: 6 KTKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNNKGKLVIIANNCPPL 55 >ref|XP_020584323.1| 60S ribosomal protein L30 [Phalaenopsis equestris] Length = 112 Score = 55.5 bits (132), Expect = 9e-07 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLRN+ G N PPL Sbjct: 6 KTKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNNKGKLVIIANNCPPL 55 >ref|XP_008792450.1| PREDICTED: 60S ribosomal protein L30-like [Phoenix dactylifera] Length = 112 Score = 55.5 bits (132), Expect = 9e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG 188 K +K TESINN LAL MKS KY LG+K VLRSLRNS G Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRNSKG 43 >ref|XP_020680617.1| 60S ribosomal protein L30 [Dendrobium catenatum] gb|PKU82281.1| 60S ribosomal protein L30 [Dendrobium catenatum] Length = 111 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLR+S G N PPL Sbjct: 6 KTKKSTESINNRLALVMKSGKYTLGYKTVLRSLRSSKGKLVIIANNCPPL 55 >gb|PKA66350.1| 60S ribosomal protein L30 [Apostasia shenzhenica] Length = 112 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLR+S G N PPL Sbjct: 6 KAKKSTESINNRLALVMKSGKYTLGYKTVLRSLRSSKGKLVIIANNCPPL 55 >ref|XP_010922949.1| PREDICTED: 60S ribosomal protein L30 [Elaeis guineensis] Length = 112 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K ESINN LAL MKS KY LG+K VLRSLRNS G N PPL Sbjct: 6 KAKKSAESINNRLALVMKSGKYTLGYKTVLRSLRNSKGKLILIANNCPPL 55 >ref|XP_020102250.1| 60S ribosomal protein L30 [Ananas comosus] gb|OAY85652.1| 60S ribosomal protein L30 [Ananas comosus] Length = 112 Score = 54.3 bits (129), Expect = 2e-06 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLRSLR S G N PPL Sbjct: 6 KTKKSTESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLVIIANNCPPL 55 >ref|XP_020253647.1| 60S ribosomal protein L30-like [Asparagus officinalis] gb|ONK77986.1| uncharacterized protein A4U43_C02F13020 [Asparagus officinalis] Length = 112 Score = 53.9 bits (128), Expect = 3e-06 Identities = 31/50 (62%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSN------GNPFPPL 206 K +K TESINN LAL MKS KY LGFK VLRSLR+S N PPL Sbjct: 6 KTKKTTESINNRLALVMKSGKYTLGFKTVLRSLRSSKAKLIIIANNCPPL 55 >gb|PNT21621.1| hypothetical protein POPTR_009G158700v3 [Populus trichocarpa] Length = 93 Score = 53.1 bits (126), Expect = 4e-06 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K ESINN LAL MKS KY LG+K VL+SLRNS G N PPL Sbjct: 6 KTKKTHESINNRLALVMKSGKYTLGYKTVLKSLRNSKGKLIIISNNCPPL 55 >ref|XP_020113819.1| 60S ribosomal protein L30-like [Ananas comosus] gb|OAY65427.1| 60S ribosomal protein L30 [Ananas comosus] Length = 112 Score = 53.5 bits (127), Expect = 5e-06 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K TESINN LAL MKS KY LG+K VLR+LR+S G N PPL Sbjct: 6 KTKKSTESINNKLALVMKSGKYTLGYKTVLRTLRSSKGKLIIIANNCPPL 55 >ref|XP_008806614.1| PREDICTED: 60S ribosomal protein L30 [Phoenix dactylifera] Length = 112 Score = 53.5 bits (127), Expect = 5e-06 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K ESINN LAL MKS KY LG+K VLRSLRN+ G N PPL Sbjct: 6 KTKKTQESINNRLALVMKSGKYTLGYKTVLRSLRNNKGKLVLIANNCPPL 55 >ref|XP_006379356.1| hypothetical protein POPTR_0009s16030g [Populus trichocarpa] gb|PNT21619.1| hypothetical protein POPTR_009G158700v3 [Populus trichocarpa] Length = 98 Score = 53.1 bits (126), Expect = 5e-06 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 75 KLQKITESINNTLALAMKSAKYGLGFKIVLRSLRNSNG------NPFPPL 206 K +K ESINN LAL MKS KY LG+K VL+SLRNS G N PPL Sbjct: 6 KTKKTHESINNRLALVMKSGKYTLGYKTVLKSLRNSKGKLIIISNNCPPL 55