BLASTX nr result
ID: Ophiopogon25_contig00035088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035088 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60799.1| uncharacterized protein A4U43_C08F22750 [Asparagu... 56 1e-06 >gb|ONK60799.1| uncharacterized protein A4U43_C08F22750 [Asparagus officinalis] Length = 169 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 170 GCKTKNALIPSTFVPERGILVTLSLPLQRTCSEPPIPEPSSMALP 304 GCK+KN +IPST +PER ILV + P Q T SEPP PEPSS+A P Sbjct: 46 GCKSKN-IIPSTSIPERRILVATNQPPQCTHSEPPHPEPSSIAKP 89