BLASTX nr result
ID: Ophiopogon25_contig00035017
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00035017 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OCT91703.1| hypothetical protein XELAEV_18014765mg [Xenopus l... 55 4e-06 >gb|OCT91703.1| hypothetical protein XELAEV_18014765mg [Xenopus laevis] Length = 417 Score = 55.5 bits (132), Expect = 4e-06 Identities = 40/127 (31%), Positives = 58/127 (45%) Frame = -1 Query: 419 SCSPMNSAAPGLGSQPSLSRGHSRADSQLDVVPSARDASRICSPSLACNSPRVSLGNHPI 240 S S +S + S PS S S + S S+ +S SPS + +SP S + P Sbjct: 19 SSSSSSSPSSSSSSSPSSSSSSSPSSSSPSSSSSSPSSSSSSSPSSSSSSPSSSSSSSPS 78 Query: 239 PAGEQLINSPSSMVLDEPGSGPSMGQSIGSSATLANSTSKSLEASGMQPSSSMGPASGSV 60 + +S SS S PS S SS++ +S+S S +S PSSS P+S S Sbjct: 79 SSSSSSPSSSSSSSSPSSSSSPSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSSPSSSSS 138 Query: 59 AGVSEST 39 + S S+ Sbjct: 139 SSPSSSS 145