BLASTX nr result
ID: Ophiopogon25_contig00034965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00034965 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK70407.1|AF369930_2 pol polyprotein [Citrus x paradisi] 41 4e-06 >gb|AAK70407.1|AF369930_2 pol polyprotein [Citrus x paradisi] Length = 701 Score = 40.8 bits (94), Expect(2) = 4e-06 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +3 Query: 381 DLIHSGTCDYKRFASRRDEKYFITFIDNHSRH 476 DLIHS CD+K +R KYFITFID+ +++ Sbjct: 518 DLIHSDICDFKSIQTRGGNKYFITFIDDCTKY 549 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 25/95 (26%), Positives = 52/95 (54%), Gaps = 10/95 (10%) Frame = +1 Query: 139 YLTEGMYKTRNINYALVINK----ASVFVCSSSLWHHRL--L*KDAMQKL---KLLSNFG 291 Y+ +G++K + IN ++ + SS++WH RL + ++++KL K + NF Sbjct: 428 YVNDGLFKLNVMTLKPTINNKATSSAYLLESSNIWHGRLGHVNFNSLRKLINMKHIPNFQ 487 Query: 292 DDKLSRCEV-YQTKITRKSFPRVTRNTQTCSILYT 393 D +C+ + K+TR SF + RN++ ++++ Sbjct: 488 IDLKHKCKTCVEAKLTRSSFQIIQRNSEPLDLIHS 522