BLASTX nr result
ID: Ophiopogon25_contig00034910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00034910 (655 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010919793.1| PREDICTED: DNA repair endonuclease UVH1 isof... 59 2e-06 ref|XP_010919791.1| PREDICTED: DNA repair endonuclease UVH1 isof... 59 2e-06 ref|XP_010919790.1| PREDICTED: DNA repair endonuclease UVH1 isof... 59 2e-06 ref|XP_020093852.1| DNA repair endonuclease UVH1 [Ananas comosus] 57 6e-06 gb|OAY85326.1| DNA repair endonuclease UVH1 [Ananas comosus] 57 6e-06 >ref|XP_010919793.1| PREDICTED: DNA repair endonuclease UVH1 isoform X3 [Elaeis guineensis] Length = 935 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +1 Query: 124 PKDLPSDLPSHHRPALYSSGAALFLAP-LLITDLLTSYV 237 P D+P DLPSHHR ALYSSGAALF+ P +LI DLLTS V Sbjct: 85 PSDIPGDLPSHHRTALYSSGAALFVTPRILIADLLTSRV 123 >ref|XP_010919791.1| PREDICTED: DNA repair endonuclease UVH1 isoform X2 [Elaeis guineensis] Length = 935 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +1 Query: 124 PKDLPSDLPSHHRPALYSSGAALFLAP-LLITDLLTSYV 237 P D+P DLPSHHR ALYSSGAALF+ P +LI DLLTS V Sbjct: 85 PSDIPGDLPSHHRTALYSSGAALFVTPRILIADLLTSRV 123 >ref|XP_010919790.1| PREDICTED: DNA repair endonuclease UVH1 isoform X1 [Elaeis guineensis] Length = 1004 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +1 Query: 124 PKDLPSDLPSHHRPALYSSGAALFLAP-LLITDLLTSYV 237 P D+P DLPSHHR ALYSSGAALF+ P +LI DLLTS V Sbjct: 85 PSDIPGDLPSHHRTALYSSGAALFVTPRILIADLLTSRV 123 >ref|XP_020093852.1| DNA repair endonuclease UVH1 [Ananas comosus] Length = 977 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +1 Query: 124 PKDLPSDLPSHHRPALYSSGAALFLAP-LLITDLLTS 231 P D+P DLPSHHR ALYSSGAALF+ P +L+ DLLTS Sbjct: 75 PSDVPGDLPSHHRAALYSSGAALFVTPRILVADLLTS 111 >gb|OAY85326.1| DNA repair endonuclease UVH1 [Ananas comosus] Length = 977 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +1 Query: 124 PKDLPSDLPSHHRPALYSSGAALFLAP-LLITDLLTS 231 P D+P DLPSHHR ALYSSGAALF+ P +L+ DLLTS Sbjct: 75 PSDVPGDLPSHHRAALYSSGAALFVTPRILVADLLTS 111