BLASTX nr result
ID: Ophiopogon25_contig00034742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00034742 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259492.1| nudix hydrolase 13, mitochondrial-like [Aspa... 57 2e-06 ref|XP_020588744.1| nudix hydrolase 13, mitochondrial-like [Phal... 55 9e-06 >ref|XP_020259492.1| nudix hydrolase 13, mitochondrial-like [Asparagus officinalis] ref|XP_020259493.1| nudix hydrolase 13, mitochondrial-like [Asparagus officinalis] gb|ONK72133.1| uncharacterized protein A4U43_C04F16100 [Asparagus officinalis] Length = 244 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -2 Query: 114 NTVQARVGREKQRYDNYFRLVAGCIPYRL--DVEKSC 10 N +QARVGREKQRY++ FRLVAGCIPYRL DV++ C Sbjct: 5 NGIQARVGREKQRYEDKFRLVAGCIPYRLKNDVKERC 41 >ref|XP_020588744.1| nudix hydrolase 13, mitochondrial-like [Phalaenopsis equestris] ref|XP_020588745.1| nudix hydrolase 13, mitochondrial-like [Phalaenopsis equestris] Length = 207 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = -2 Query: 120 ASNTVQARVGREKQRYDNYFRLVAGCIPYRL--DVEKS 13 +S T+QAR GR QRY+N+FRLVAGCIPYR+ +VEKS Sbjct: 2 SSTTLQARTGRHLQRYENHFRLVAGCIPYRINRNVEKS 39