BLASTX nr result
ID: Ophiopogon25_contig00034567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00034567 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] 57 1e-06 >emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] Length = 1915 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -3 Query: 167 KILSWNVRGLGCPVKR-SIKNFISLKRMDMILFQETKLEIWSDRLASS 27 KILSWN RGLG KR +++ F+S + D+++FQETK EIW RL SS Sbjct: 738 KILSWNTRGLGSRKKRRTVRRFLSTQNPDVVMFQETKREIWDRRLVSS 785