BLASTX nr result
ID: Ophiopogon25_contig00034005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00034005 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269645.1| serine/threonine-protein kinase tricorner-li... 58 5e-07 >ref|XP_020269645.1| serine/threonine-protein kinase tricorner-like [Asparagus officinalis] gb|ONK65743.1| uncharacterized protein A4U43_C06F470 [Asparagus officinalis] Length = 572 Score = 58.2 bits (139), Expect = 5e-07 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -3 Query: 403 ETEPNSEKKPVLGSFLNLLPTQLEVSE-NPESSDEYAKPSPYQPPTRHR 260 ETE +EKKPVLGSFLNLLPTQLEV E + ES ++ K S YQP T+ R Sbjct: 524 ETETITEKKPVLGSFLNLLPTQLEVPESSQESFEDSNKSSSYQPLTQRR 572