BLASTX nr result
ID: Ophiopogon25_contig00033967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033967 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY32755.1| hypothetical protein CUMW_003950 [Citrus unshiu] 56 6e-06 >dbj|GAY32755.1| hypothetical protein CUMW_003950 [Citrus unshiu] Length = 413 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -2 Query: 493 LGRIYLGMHSXXXXXXXXXXXXXXLSFWLTVHEFIDDFIISGQNG 359 +GRIYLGMHS L+FWLTVHE++D+FIISGQNG Sbjct: 190 VGRIYLGMHSLVDIIAGLALGLAVLAFWLTVHEYVDNFIISGQNG 234