BLASTX nr result
ID: Ophiopogon25_contig00033940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033940 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255032.1| microtubule-associated protein 70-1-like [As... 65 5e-09 ref|XP_008775179.1| PREDICTED: microtubule-associated protein 70... 62 4e-08 ref|XP_009383720.1| PREDICTED: microtubule-associated protein 70... 61 1e-07 ref|XP_020672217.1| microtubule-associated protein 70-1-like [De... 59 6e-07 ref|XP_010914823.1| PREDICTED: microtubule-associated protein 70... 59 8e-07 gb|PKA52682.1| Microtubule-associated protein 70-2 [Apostasia sh... 59 8e-07 ref|XP_006840410.3| microtubule-associated protein 70-2 isoform ... 57 4e-06 >ref|XP_020255032.1| microtubule-associated protein 70-1-like [Asparagus officinalis] ref|XP_020255033.1| microtubule-associated protein 70-1-like [Asparagus officinalis] ref|XP_020255034.1| microtubule-associated protein 70-1-like [Asparagus officinalis] ref|XP_020255035.1| microtubule-associated protein 70-1-like [Asparagus officinalis] gb|ONK78818.1| uncharacterized protein A4U43_C02F22750 [Asparagus officinalis] Length = 586 Score = 65.1 bits (157), Expect = 5e-09 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 DKDREL EA S IKGLRL E+A KAL++VT ELE VEKL+ASE +ENK Sbjct: 65 DKDRELAEAHSEIKGLRLMERAKDKALSEVTEELEKTVEKLEASEATIENK 115 >ref|XP_008775179.1| PREDICTED: microtubule-associated protein 70-2-like, partial [Phoenix dactylifera] Length = 499 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 +KDREL EA IKGL+L E+A KALA VT ELE ++EKLQASE +ENK Sbjct: 59 EKDRELAEAHGEIKGLKLTERAKDKALADVTEELEKIMEKLQASEATLENK 109 >ref|XP_009383720.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata subsp. malaccensis] ref|XP_009383721.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata subsp. malaccensis] Length = 607 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 DKDR L E S IKGLRL E+A KAL +V+ EL+ MVEK QASE A+ENK Sbjct: 83 DKDRALFETYSEIKGLRLMERAKDKALTEVSEELQKMVEKFQASEVALENK 133 >ref|XP_020672217.1| microtubule-associated protein 70-1-like [Dendrobium catenatum] ref|XP_020672218.1| microtubule-associated protein 70-1-like [Dendrobium catenatum] ref|XP_020672219.1| microtubule-associated protein 70-1-like [Dendrobium catenatum] ref|XP_020672220.1| microtubule-associated protein 70-1-like [Dendrobium catenatum] gb|PKU77792.1| Microtubule-associated protein 70-1 [Dendrobium catenatum] Length = 603 Score = 58.9 bits (141), Expect = 6e-07 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 DKDREL +A IK LRL E+A KALA+VT ELE M KLQASE A+E+K Sbjct: 77 DKDRELADANGEIKSLRLIERAKDKALAEVTEELEKMSGKLQASEAALEDK 127 >ref|XP_010914823.1| PREDICTED: microtubule-associated protein 70-1 [Elaeis guineensis] Length = 586 Score = 58.5 bits (140), Expect = 8e-07 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 +K+REL EA KGL+L E+A KALA+VT ELE ++EKLQASE +ENK Sbjct: 59 EKNRELAEAHGETKGLKLTERAKDKALAEVTEELEKIMEKLQASEANLENK 109 >gb|PKA52682.1| Microtubule-associated protein 70-2 [Apostasia shenzhenica] Length = 599 Score = 58.5 bits (140), Expect = 8e-07 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 275 DKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 +KDREL EA S IK LRL E+A KAL +VTVELE + EKLQA E A+E+K Sbjct: 76 EKDRELGEALSEIKSLRLIERAKDKALTEVTVELEKIAEKLQALEAALEDK 126 >ref|XP_006840410.3| microtubule-associated protein 70-2 isoform X1 [Amborella trichopoda] gb|ERN02085.1| hypothetical protein AMTR_s00045p00152960 [Amborella trichopoda] Length = 622 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +2 Query: 272 LDKDRELVEARS*IKGLRLKEQAIGKALAKVTVELEMMVEKLQASETAMENK 427 +DK+RELV+A++ IK L+L ++ KAL ++T EL MVEK QASE A+ENK Sbjct: 79 IDKNRELVDAQAEIKALKLTDRIKEKALEELTEELRKMVEKFQASEAALENK 130