BLASTX nr result
ID: Ophiopogon25_contig00033854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00033854 (1383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272073.1| auxin-responsive protein SAUR50-like [Aspara... 51 1e-10 >ref|XP_020272073.1| auxin-responsive protein SAUR50-like [Asparagus officinalis] gb|ONK63742.1| uncharacterized protein A4U43_C07F18440 [Asparagus officinalis] Length = 112 Score = 51.2 bits (121), Expect(2) = 1e-10 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 885 MANAKSTKRSTTVIRAAVRSLQRSLSRPGRPEEFVPVDVKGGYF 754 MA A+S KR+ ++I+ AVR+LQR LSR R +E VP DVK G+F Sbjct: 1 MAKARSMKRNDSMIKGAVRALQRKLSRSRRSDELVPEDVKEGHF 44 Score = 45.1 bits (105), Expect(2) = 1e-10 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 767 KEDTFAVLAINHEEPKRFIVSLNCLS 690 KE FAVLA+N +EPKRF+VSLNCLS Sbjct: 40 KEGHFAVLAVNDDEPKRFVVSLNCLS 65